Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LV622_RS07570 | Genome accession | NZ_CP090001 |
| Coordinates | 1563132..1563443 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain RN6390 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1558132..1568443
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LV622_RS07535 (LV622_07535) | gcvPA | 1558634..1559980 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| LV622_RS07540 (LV622_07540) | gcvT | 1560000..1561091 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LV622_RS07545 (LV622_07545) | - | 1561250..1561774 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| LV622_RS07550 (LV622_07550) | - | 1561764..1561910 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| LV622_RS07555 (LV622_07555) | comGF | 1562007..1562504 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LV622_RS07560 (LV622_07560) | comGE | 1562422..1562721 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LV622_RS07565 (LV622_07565) | comGD | 1562708..1563154 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LV622_RS07570 (LV622_07570) | comGC | 1563132..1563443 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LV622_RS07575 (LV622_07575) | comGB | 1563457..1564527 (-) | 1071 | Protein_1489 | competence type IV pilus assembly protein ComGB | - |
| LV622_RS07580 (LV622_07580) | comGA | 1564499..1565473 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LV622_RS07585 (LV622_07585) | - | 1565525..1566148 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LV622_RS07590 (LV622_07590) | - | 1566145..1566474 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LV622_RS07595 (LV622_07595) | - | 1566474..1567460 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| LV622_RS07600 (LV622_07600) | - | 1567457..1567660 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=639989 LV622_RS07570 WP_000472256.1 1563132..1563443(-) (comGC) [Staphylococcus aureus strain RN6390]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=639989 LV622_RS07570 WP_000472256.1 1563132..1563443(-) (comGC) [Staphylococcus aureus strain RN6390]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |