Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   LUY99_RS11335 Genome accession   NZ_CP089479
Coordinates   2258240..2258710 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain 0073_III_ST239     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2247654..2290151 2258240..2258710 within 0


Gene organization within MGE regions


Location: 2247654..2290151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUY99_RS11250 - 2247654..2248859 (-) 1206 WP_000264186.1 tyrosine-type recombinase/integrase -
  LUY99_RS11255 - 2248970..2249149 (+) 180 WP_000337826.1 hypothetical protein -
  LUY99_RS11260 - 2249129..2250061 (-) 933 WP_000392181.1 hypothetical protein -
  LUY99_RS11265 - 2250093..2250818 (-) 726 WP_000661437.1 PH domain-containing protein -
  LUY99_RS11270 - 2250846..2251520 (-) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  LUY99_RS11275 - 2251537..2251869 (-) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  LUY99_RS11280 - 2252133..2252327 (+) 195 WP_000108122.1 helix-turn-helix transcriptional regulator -
  LUY99_RS11285 - 2252327..2253094 (+) 768 WP_001002757.1 phage antirepressor Ant -
  LUY99_RS11290 tscA 2253095..2253319 (+) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  LUY99_RS11295 - 2253359..2253458 (+) 100 Protein_2202 hypothetical protein -
  LUY99_RS11300 - 2253607..2253870 (+) 264 WP_001124198.1 helix-turn-helix domain-containing protein -
  LUY99_RS11305 - 2253882..2254043 (+) 162 WP_000066021.1 DUF1270 family protein -
  LUY99_RS11310 - 2254135..2254395 (+) 261 WP_000291089.1 DUF1108 family protein -
  LUY99_RS11315 - 2254404..2254667 (+) 264 WP_001205732.1 hypothetical protein -
  LUY99_RS11320 - 2254676..2256619 (+) 1944 WP_000700555.1 AAA family ATPase -
  LUY99_RS11325 - 2256621..2257541 (+) 921 WP_000180598.1 recombinase RecT -
  LUY99_RS11330 - 2257622..2258239 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  LUY99_RS11335 ssbA 2258240..2258710 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  LUY99_RS11340 - 2258740..2259633 (+) 894 WP_000148333.1 DnaD domain-containing protein -
  LUY99_RS11345 - 2259640..2259858 (+) 219 WP_000338528.1 hypothetical protein -
  LUY99_RS11350 - 2259867..2260271 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  LUY99_RS11355 - 2260284..2260656 (+) 373 Protein_2214 SA1788 family PVL leukocidin-associated protein -
  LUY99_RS11360 - 2260656..2260913 (+) 258 WP_000111491.1 DUF3310 domain-containing protein -
  LUY99_RS11365 - 2260916..2261158 (+) 243 WP_000221871.1 SAV1978 family virulence-associated passenger protein -
  LUY99_RS11370 - 2261171..2261572 (+) 402 WP_000695762.1 hypothetical protein -
  LUY99_RS11375 - 2261569..2261916 (+) 348 WP_000979209.1 YopX family protein -
  LUY99_RS11380 - 2261913..2262221 (+) 309 WP_000144710.1 hypothetical protein -
  LUY99_RS11385 - 2262214..2262462 (+) 249 WP_001065026.1 DUF1024 family protein -
  LUY99_RS11390 - 2262455..2262991 (+) 537 WP_000185663.1 dUTPase -
  LUY99_RS11395 - 2263028..2263228 (+) 201 WP_000195821.1 DUF1381 domain-containing protein -
  LUY99_RS11400 - 2263327..2263563 (+) 237 WP_000608279.1 hypothetical protein -
  LUY99_RS11405 rinB 2263556..2263729 (+) 174 WP_000591891.1 transcriptional activator RinB -
  LUY99_RS11410 - 2263730..2264095 (+) 366 WP_000989954.1 hypothetical protein -
  LUY99_RS11415 - 2264096..2264242 (+) 147 WP_000989960.1 hypothetical protein -
  LUY99_RS11420 - 2264266..2264706 (+) 441 WP_000162703.1 RinA family phage transcriptional activator -
  LUY99_RS11425 - 2265017..2265511 (+) 495 WP_000594082.1 terminase small subunit -
  LUY99_RS11430 - 2265504..2266712 (+) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  LUY99_RS11435 - 2266726..2268144 (+) 1419 WP_000283553.1 phage portal protein -
  LUY99_RS11440 - 2268083..2269066 (+) 984 WP_014532414.1 phage head morphogenesis protein -
  LUY99_RS11445 - 2269068..2269274 (+) 207 WP_000346033.1 hypothetical protein -
  LUY99_RS11450 - 2269379..2269975 (+) 597 WP_000366932.1 phage scaffolding protein -
  LUY99_RS11455 - 2269996..2270820 (+) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  LUY99_RS11460 - 2270837..2271163 (+) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  LUY99_RS11465 - 2271163..2271477 (+) 315 WP_000338935.1 phage head-tail connector protein -
  LUY99_RS11470 - 2271470..2271805 (+) 336 WP_017431444.1 phage head closure protein -
  LUY99_RS11475 - 2271792..2272205 (+) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  LUY99_RS11480 - 2272218..2272655 (+) 438 WP_000270196.1 DUF3168 domain-containing protein -
  LUY99_RS11485 - 2272642..2273202 (+) 561 WP_000046067.1 hypothetical protein -
  LUY99_RS11490 - 2273264..2273758 (+) 495 WP_000141082.1 tail assembly chaperone -
  LUY99_RS11495 - 2273779..2274120 (+) 342 WP_001580347.1 hypothetical protein -
  LUY99_RS11500 - 2274123..2277092 (+) 2970 WP_000414234.1 terminase -
  LUY99_RS11505 - 2277107..2278042 (+) 936 WP_000560193.1 phage tail domain-containing protein -
  LUY99_RS11510 - 2278053..2279936 (+) 1884 WP_001144702.1 SGNH/GDSL hydrolase family protein -
  LUY99_RS11515 - 2279949..2281847 (+) 1899 WP_000323252.1 hypothetical protein -
  LUY99_RS11520 - 2281847..2283670 (+) 1824 WP_000259636.1 phage baseplate upper protein -
  LUY99_RS11525 - 2283670..2284047 (+) 378 WP_000869363.1 DUF2977 domain-containing protein -
  LUY99_RS11530 - 2284057..2284230 (+) 174 WP_015990323.1 XkdX family protein -
  LUY99_RS11535 - 2284271..2284570 (+) 300 WP_000466769.1 DUF2951 domain-containing protein -
  LUY99_RS11540 - 2284707..2286581 (+) 1875 WP_000524040.1 glucosaminidase domain-containing protein -
  LUY99_RS11545 - 2286594..2287832 (+) 1239 WP_000276640.1 BppU family phage baseplate upper protein -
  LUY99_RS11550 - 2287837..2288232 (+) 396 WP_000387945.1 hypothetical protein -
  LUY99_RS11555 - 2288288..2288725 (+) 438 WP_000354132.1 phage holin -
  LUY99_RS11560 - 2288706..2290151 (+) 1446 WP_001148131.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=637183 LUY99_RS11335 WP_000934759.1 2258240..2258710(+) (ssbA) [Staphylococcus aureus strain 0073_III_ST239]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=637183 LUY99_RS11335 WP_000934759.1 2258240..2258710(+) (ssbA) [Staphylococcus aureus strain 0073_III_ST239]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365