Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUY99_RS11335 | Genome accession | NZ_CP089479 |
| Coordinates | 2258240..2258710 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain 0073_III_ST239 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2247654..2290151 | 2258240..2258710 | within | 0 |
Gene organization within MGE regions
Location: 2247654..2290151
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUY99_RS11250 | - | 2247654..2248859 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| LUY99_RS11255 | - | 2248970..2249149 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| LUY99_RS11260 | - | 2249129..2250061 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| LUY99_RS11265 | - | 2250093..2250818 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| LUY99_RS11270 | - | 2250846..2251520 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LUY99_RS11275 | - | 2251537..2251869 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| LUY99_RS11280 | - | 2252133..2252327 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| LUY99_RS11285 | - | 2252327..2253094 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| LUY99_RS11290 | tscA | 2253095..2253319 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| LUY99_RS11295 | - | 2253359..2253458 (+) | 100 | Protein_2202 | hypothetical protein | - |
| LUY99_RS11300 | - | 2253607..2253870 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| LUY99_RS11305 | - | 2253882..2254043 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| LUY99_RS11310 | - | 2254135..2254395 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| LUY99_RS11315 | - | 2254404..2254667 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LUY99_RS11320 | - | 2254676..2256619 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| LUY99_RS11325 | - | 2256621..2257541 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| LUY99_RS11330 | - | 2257622..2258239 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| LUY99_RS11335 | ssbA | 2258240..2258710 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| LUY99_RS11340 | - | 2258740..2259633 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| LUY99_RS11345 | - | 2259640..2259858 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LUY99_RS11350 | - | 2259867..2260271 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LUY99_RS11355 | - | 2260284..2260656 (+) | 373 | Protein_2214 | SA1788 family PVL leukocidin-associated protein | - |
| LUY99_RS11360 | - | 2260656..2260913 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| LUY99_RS11365 | - | 2260916..2261158 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| LUY99_RS11370 | - | 2261171..2261572 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| LUY99_RS11375 | - | 2261569..2261916 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| LUY99_RS11380 | - | 2261913..2262221 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| LUY99_RS11385 | - | 2262214..2262462 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| LUY99_RS11390 | - | 2262455..2262991 (+) | 537 | WP_000185663.1 | dUTPase | - |
| LUY99_RS11395 | - | 2263028..2263228 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| LUY99_RS11400 | - | 2263327..2263563 (+) | 237 | WP_000608279.1 | hypothetical protein | - |
| LUY99_RS11405 | rinB | 2263556..2263729 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| LUY99_RS11410 | - | 2263730..2264095 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| LUY99_RS11415 | - | 2264096..2264242 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| LUY99_RS11420 | - | 2264266..2264706 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| LUY99_RS11425 | - | 2265017..2265511 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| LUY99_RS11430 | - | 2265504..2266712 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| LUY99_RS11435 | - | 2266726..2268144 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| LUY99_RS11440 | - | 2268083..2269066 (+) | 984 | WP_014532414.1 | phage head morphogenesis protein | - |
| LUY99_RS11445 | - | 2269068..2269274 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| LUY99_RS11450 | - | 2269379..2269975 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| LUY99_RS11455 | - | 2269996..2270820 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| LUY99_RS11460 | - | 2270837..2271163 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| LUY99_RS11465 | - | 2271163..2271477 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| LUY99_RS11470 | - | 2271470..2271805 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| LUY99_RS11475 | - | 2271792..2272205 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LUY99_RS11480 | - | 2272218..2272655 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| LUY99_RS11485 | - | 2272642..2273202 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| LUY99_RS11490 | - | 2273264..2273758 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| LUY99_RS11495 | - | 2273779..2274120 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| LUY99_RS11500 | - | 2274123..2277092 (+) | 2970 | WP_000414234.1 | terminase | - |
| LUY99_RS11505 | - | 2277107..2278042 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| LUY99_RS11510 | - | 2278053..2279936 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| LUY99_RS11515 | - | 2279949..2281847 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| LUY99_RS11520 | - | 2281847..2283670 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| LUY99_RS11525 | - | 2283670..2284047 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| LUY99_RS11530 | - | 2284057..2284230 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| LUY99_RS11535 | - | 2284271..2284570 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| LUY99_RS11540 | - | 2284707..2286581 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| LUY99_RS11545 | - | 2286594..2287832 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| LUY99_RS11550 | - | 2287837..2288232 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| LUY99_RS11555 | - | 2288288..2288725 (+) | 438 | WP_000354132.1 | phage holin | - |
| LUY99_RS11560 | - | 2288706..2290151 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=637183 LUY99_RS11335 WP_000934759.1 2258240..2258710(+) (ssbA) [Staphylococcus aureus strain 0073_III_ST239]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=637183 LUY99_RS11335 WP_000934759.1 2258240..2258710(+) (ssbA) [Staphylococcus aureus strain 0073_III_ST239]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |