Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LM510_RS02515 | Genome accession | NZ_CP086560 |
| Coordinates | 511636..512094 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain E509 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 503225..562369 | 511636..512094 | within | 0 |
Gene organization within MGE regions
Location: 503225..562369
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LM510_RS02450 (LM510_02450) | prgU | 503778..504134 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| LM510_RS02455 (LM510_02455) | - | 504156..504542 (+) | 387 | WP_002377929.1 | hypothetical protein | - |
| LM510_RS02460 (LM510_02460) | - | 504688..504948 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| LM510_RS02465 (LM510_02465) | - | 504959..505837 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| LM510_RS02470 (LM510_02470) | - | 505857..506717 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| LM510_RS02475 (LM510_02475) | - | 506743..508013 (+) | 1271 | Protein_457 | CHAP domain-containing protein | - |
| LM510_RS02480 (LM510_02480) | - | 508016..508633 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| LM510_RS14635 | - | 508617..509032 (+) | 416 | Protein_459 | thioredoxin domain-containing protein | - |
| LM510_RS02490 (LM510_02490) | - | 509032..509346 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| LM510_RS02495 (LM510_02495) | - | 509339..510373 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| LM510_RS02500 (LM510_02500) | - | 510378..510638 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| LM510_RS02505 (LM510_02505) | - | 510638..511027 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| LM510_RS02510 (LM510_02510) | - | 511059..511541 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| LM510_RS02515 (LM510_02515) | ssb | 511636..512094 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| LM510_RS02520 (LM510_02520) | - | 512199..514691 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| LM510_RS02525 (LM510_02525) | - | 514648..515046 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| LM510_RS02530 (LM510_02530) | - | 515059..517404 (+) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| LM510_RS02535 (LM510_02535) | - | 517391..519649 (+) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| LM510_RS02540 (LM510_02540) | - | 520172..520957 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| LM510_RS02545 (LM510_02545) | - | 520963..521451 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| LM510_RS02550 (LM510_02550) | - | 522043..522309 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| LM510_RS02555 (LM510_02555) | - | 522342..522842 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| LM510_RS02560 (LM510_02560) | - | 522855..523103 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| LM510_RS02565 (LM510_02565) | - | 523179..523595 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| LM510_RS02570 (LM510_02570) | - | 523619..524203 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| LM510_RS02575 (LM510_02575) | - | 524314..524580 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| LM510_RS02580 (LM510_02580) | - | 524573..524848 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| LM510_RS02585 (LM510_02585) | - | 525039..525683 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| LM510_RS02590 (LM510_02590) | - | 525816..526698 (+) | 883 | Protein_480 | IS256 family transposase | - |
| LM510_RS02595 (LM510_02595) | - | 527003..528040 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| LM510_RS02600 (LM510_02600) | - | 528066..529004 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| LM510_RS02605 (LM510_02605) | - | 529132..529401 (-) | 270 | Protein_483 | LPXTG cell wall anchor domain-containing protein | - |
| LM510_RS02610 (LM510_02610) | - | 529491..529676 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| LM510_RS02615 (LM510_02615) | - | 529708..530316 (+) | 609 | Protein_485 | IS6 family transposase | - |
| LM510_RS02620 (LM510_02620) | bsh | 530985..531959 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| LM510_RS02625 (LM510_02625) | - | 532183..532827 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| LM510_RS02630 (LM510_02630) | - | 533000..533314 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| LM510_RS02635 (LM510_02635) | cylR2 | 533652..533852 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| LM510_RS02640 (LM510_02640) | cylL-L | 534256..534462 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| LM510_RS02645 (LM510_02645) | cylL-S | 534496..534687 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| LM510_RS02650 (LM510_02650) | - | 534748..537729 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| LM510_RS02655 (LM510_02655) | - | 537741..539885 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| LM510_RS02660 (LM510_02660) | - | 539882..541120 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| LM510_RS02665 (LM510_02665) | - | 541121..542104 (+) | 984 | WP_128701265.1 | site-2 protease family protein | - |
| LM510_RS02670 (LM510_02670) | - | 542457..543020 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| LM510_RS02675 (LM510_02675) | - | 543457..543924 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| LM510_RS02680 (LM510_02680) | - | 544002..544583 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| LM510_RS02685 (LM510_02685) | - | 544678..544884 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| LM510_RS02690 (LM510_02690) | amaP | 545154..545720 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| LM510_RS02695 (LM510_02695) | - | 545737..545928 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| LM510_RS02700 (LM510_02700) | - | 545957..546493 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| LM510_RS02705 (LM510_02705) | - | 546768..552389 (+) | 5622 | WP_115256592.1 | Rib/alpha-like domain-containing protein | - |
| LM510_RS02710 (LM510_02710) | - | 552589..553797 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| LM510_RS02715 (LM510_02715) | - | 553927..554343 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| LM510_RS02720 (LM510_02720) | - | 554479..554580 (-) | 102 | Protein_506 | IS30 family transposase | - |
| LM510_RS02725 (LM510_02725) | - | 554568..555305 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| LM510_RS02730 (LM510_02730) | - | 555351..555971 (-) | 621 | WP_033591050.1 | recombinase family protein | - |
| LM510_RS02735 (LM510_02735) | - | 556155..556774 (+) | 620 | Protein_509 | recombinase family protein | - |
| LM510_RS02740 (LM510_02740) | - | 556883..557065 (+) | 183 | WP_002358529.1 | hypothetical protein | - |
| LM510_RS02745 (LM510_02745) | - | 557521..558339 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| LM510_RS02750 (LM510_02750) | - | 558495..559202 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| LM510_RS02755 (LM510_02755) | - | 559195..560697 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| LM510_RS02760 (LM510_02760) | - | 560708..561190 (+) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=625369 LM510_RS02515 WP_002365911.1 511636..512094(+) (ssb) [Enterococcus faecalis strain E509]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=625369 LM510_RS02515 WP_002365911.1 511636..512094(+) (ssb) [Enterococcus faecalis strain E509]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |