Detailed information NTG0611274

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LE166_RS04435
• Genome accession: NZ_CP084437
• Coordinates: 873407..873721 (+)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain RMLUG3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 868407..878721

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LE166_RS04405 (LE166_04400)	-	869199..869402 (+)	204	WP_002459010.1	YqgQ family protein	-
LE166_RS04410 (LE166_04405)	-	869399..870385 (+)	987	WP_002491907.1	ROK family glucokinase	-
LE166_RS04415 (LE166_04410)	-	870385..870708 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
LE166_RS04420 (LE166_04415)	-	870712..871335 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
LE166_RS04425 (LE166_04420)	comGA	871382..872356 (+)	975	WP_002491905.1	competence type IV pilus ATPase ComGA	Machinery gene
LE166_RS04430 (LE166_04425)	comGB	872328..873392 (+)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
LE166_RS04435 (LE166_04430)	comGC	873407..873721 (+)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
LE166_RS04440 (LE166_04435)	comGD	873699..874148 (+)	450	WP_037540764.1	competence type IV pilus minor pilin ComGD	-
LE166_RS04445 (LE166_04440)	-	874135..874428 (+)	294	WP_002459018.1	hypothetical protein	-
LE166_RS04450 (LE166_04445)	-	874490..874849 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
LE166_RS04455 (LE166_04450)	-	875003..875521 (+)	519	WP_002459021.1	shikimate kinase	-
LE166_RS04460 (LE166_04455)	gcvT	875691..876782 (+)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
LE166_RS04465 (LE166_04460)	gcvPA	876799..878148 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=611274 LE166_RS04435 WP_002459016.1 873407..873721(+) (comGC) [Staphylococcus lugdunensis strain RMLUG3]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=611274 LE166_RS04435 WP_002459016.1 873407..873721(+) (comGC) [Staphylococcus lugdunensis strain RMLUG3]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375