Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | K7H07_RS06450 | Genome accession | NZ_CP082336 |
| Coordinates | 1332618..1332926 (+) | Length | 102 a.a. |
| NCBI ID | WP_103387866.1 | Uniprot ID | - |
| Organism | Staphylococcus arlettae strain AHKW2e | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1327618..1337926
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7H07_RS06420 (K7H07_06420) | - | 1327946..1328140 (+) | 195 | WP_002509763.1 | YqgQ family protein | - |
| K7H07_RS06425 (K7H07_06425) | - | 1328607..1329593 (+) | 987 | WP_002509762.1 | glucokinase | - |
| K7H07_RS06430 (K7H07_06430) | - | 1329593..1329931 (+) | 339 | WP_002509761.1 | MTH1187 family thiamine-binding protein | - |
| K7H07_RS06435 (K7H07_06435) | - | 1329918..1330535 (+) | 618 | WP_002509760.1 | MBL fold metallo-hydrolase | - |
| K7H07_RS06440 (K7H07_06440) | comGA | 1330588..1331562 (+) | 975 | WP_193325327.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| K7H07_RS06445 (K7H07_06445) | comGB | 1331534..1332586 (+) | 1053 | WP_193325328.1 | competence type IV pilus assembly protein ComGB | - |
| K7H07_RS06450 (K7H07_06450) | comGC | 1332618..1332926 (+) | 309 | WP_103387866.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| K7H07_RS06455 (K7H07_06455) | comGD | 1332916..1333353 (+) | 438 | WP_103387867.1 | competence type IV pilus minor pilin ComGD | - |
| K7H07_RS06460 (K7H07_06460) | - | 1333334..1333633 (+) | 300 | WP_002509755.1 | hypothetical protein | - |
| K7H07_RS06465 (K7H07_06465) | - | 1333608..1334036 (+) | 429 | WP_002509754.1 | competence type IV pilus minor pilin ComGF | - |
| K7H07_RS06470 (K7H07_06470) | - | 1334204..1334716 (+) | 513 | WP_002509752.1 | shikimate kinase | - |
| K7H07_RS06475 (K7H07_06475) | gcvT | 1334884..1335975 (+) | 1092 | WP_021459931.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| K7H07_RS06480 (K7H07_06480) | gcvPA | 1335994..1337346 (+) | 1353 | WP_002509750.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 102 a.a. Molecular weight: 11303.35 Da Isoelectric Point: 9.5423
>NTDB_id=601585 K7H07_RS06450 WP_103387866.1 1332618..1332926(+) (comGC) [Staphylococcus arlettae strain AHKW2e]
MYKRTVTKAFTLIEMLLVLLIISLLLILIIPNIAKQSKHIQNTGCKAQLKMVDSQIEAYTLKNNQAPATIDDLVREGYIK
ENQKQCKSGANITITNGEAVAS
MYKRTVTKAFTLIEMLLVLLIISLLLILIIPNIAKQSKHIQNTGCKAQLKMVDSQIEAYTLKNNQAPATIDDLVREGYIK
ENQKQCKSGANITITNGEAVAS
Nucleotide
Download Length: 309 bp
>NTDB_id=601585 K7H07_RS06450 WP_103387866.1 1332618..1332926(+) (comGC) [Staphylococcus arlettae strain AHKW2e]
ATGTATAAAAGAACTGTTACAAAAGCTTTTACATTAATAGAAATGTTACTCGTACTATTAATCATTAGTTTATTACTCAT
ACTAATAATCCCTAATATTGCAAAACAATCAAAGCATATACAAAATACAGGTTGTAAAGCACAATTAAAAATGGTCGATA
GCCAAATAGAAGCATACACATTAAAAAATAATCAAGCACCAGCAACAATAGATGACCTTGTTCGAGAGGGGTATATTAAA
GAGAATCAAAAACAATGTAAATCCGGTGCAAATATTACAATTACTAATGGTGAAGCTGTTGCTAGCTAG
ATGTATAAAAGAACTGTTACAAAAGCTTTTACATTAATAGAAATGTTACTCGTACTATTAATCATTAGTTTATTACTCAT
ACTAATAATCCCTAATATTGCAAAACAATCAAAGCATATACAAAATACAGGTTGTAAAGCACAATTAAAAATGGTCGATA
GCCAAATAGAAGCATACACATTAAAAAATAATCAAGCACCAGCAACAATAGATGACCTTGTTCGAGAGGGGTATATTAAA
GAGAATCAAAAACAATGTAAATCCGGTGCAAATATTACAATTACTAATGGTGAAGCTGTTGCTAGCTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
75 |
94.118 |
0.706 |
| comGC | Staphylococcus aureus MW2 |
75 |
94.118 |
0.706 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
50 |
84.314 |
0.422 |
| comYC | Streptococcus mutans UA140 |
50.617 |
79.412 |
0.402 |
| comYC | Streptococcus mutans UA159 |
50.617 |
79.412 |
0.402 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
43.956 |
89.216 |
0.392 |
| comYC | Streptococcus suis isolate S10 |
51.316 |
74.51 |
0.382 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
46.914 |
79.412 |
0.373 |
| comGC/cglC | Streptococcus mitis SK321 |
45.238 |
82.353 |
0.373 |
| comGC/cglC | Streptococcus pneumoniae R6 |
44.048 |
82.353 |
0.363 |
| comGC/cglC | Streptococcus pneumoniae D39 |
44.048 |
82.353 |
0.363 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
44.048 |
82.353 |
0.363 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
44.048 |
82.353 |
0.363 |