Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K5K97_RS09340 | Genome accession | NZ_CP081470 |
| Coordinates | 1811582..1812049 (+) | Length | 155 a.a. |
| NCBI ID | WP_227288560.1 | Uniprot ID | - |
| Organism | Vagococcus fluvialis strain 25B2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1800949..1840609 | 1811582..1812049 | within | 0 |
Gene organization within MGE regions
Location: 1800949..1840609
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5K97_RS09245 (K5K97_09240) | - | 1800949..1802070 (-) | 1122 | WP_227288542.1 | tyrosine-type recombinase/integrase | - |
| K5K97_RS09250 (K5K97_09245) | - | 1802170..1802598 (-) | 429 | WP_227288543.1 | hypothetical protein | - |
| K5K97_RS09255 (K5K97_09250) | - | 1802688..1803317 (-) | 630 | WP_227288544.1 | LexA family transcriptional regulator | - |
| K5K97_RS09260 (K5K97_09255) | - | 1803519..1803755 (+) | 237 | WP_227288545.1 | DUF739 family protein | - |
| K5K97_RS09265 (K5K97_09260) | - | 1803767..1804663 (+) | 897 | WP_227288546.1 | DUF3102 domain-containing protein | - |
| K5K97_RS09270 (K5K97_09265) | - | 1804656..1805123 (+) | 468 | WP_227288547.1 | ORF6C domain-containing protein | - |
| K5K97_RS09275 (K5K97_09270) | - | 1805136..1805453 (+) | 318 | WP_207058582.1 | DUF771 domain-containing protein | - |
| K5K97_RS09280 (K5K97_09275) | - | 1805608..1805766 (+) | 159 | WP_227288548.1 | hypothetical protein | - |
| K5K97_RS09285 (K5K97_09280) | - | 1805763..1806434 (+) | 672 | WP_227288549.1 | N-6 DNA methylase | - |
| K5K97_RS09290 (K5K97_09285) | - | 1806435..1807376 (+) | 942 | WP_227288550.1 | site-specific integrase | - |
| K5K97_RS09295 (K5K97_09290) | - | 1807387..1807623 (+) | 237 | WP_227288551.1 | hypothetical protein | - |
| K5K97_RS09300 (K5K97_09295) | - | 1807625..1808206 (+) | 582 | WP_227288552.1 | HNH endonuclease signature motif containing protein | - |
| K5K97_RS09305 (K5K97_09300) | - | 1808209..1808580 (+) | 372 | WP_227288553.1 | hypothetical protein | - |
| K5K97_RS09310 (K5K97_09305) | - | 1808594..1808950 (+) | 357 | WP_227288554.1 | YopX family protein | - |
| K5K97_RS09315 (K5K97_09310) | - | 1809029..1809334 (+) | 306 | WP_227288555.1 | hypothetical protein | - |
| K5K97_RS09320 (K5K97_09315) | - | 1809351..1809896 (+) | 546 | WP_227288556.1 | host-nuclease inhibitor Gam family protein | - |
| K5K97_RS09325 (K5K97_09320) | - | 1809906..1810544 (+) | 639 | WP_227288557.1 | ERF family protein | - |
| K5K97_RS09330 (K5K97_09325) | - | 1810549..1811250 (+) | 702 | WP_227288558.1 | putative HNHc nuclease | - |
| K5K97_RS09335 (K5K97_09330) | - | 1811247..1811582 (+) | 336 | WP_227288559.1 | hypothetical protein | - |
| K5K97_RS09340 (K5K97_09335) | ssb | 1811582..1812049 (+) | 468 | WP_227288560.1 | single-stranded DNA-binding protein | Machinery gene |
| K5K97_RS09345 (K5K97_09340) | - | 1812064..1812849 (+) | 786 | WP_227288561.1 | phage replisome organizer N-terminal domain-containing protein | - |
| K5K97_RS09350 (K5K97_09345) | - | 1812849..1813766 (+) | 918 | WP_227288562.1 | DnaA ATPase domain-containing protein | - |
| K5K97_RS09355 (K5K97_09350) | - | 1813766..1813948 (+) | 183 | WP_227288563.1 | hypothetical protein | - |
| K5K97_RS09360 (K5K97_09355) | - | 1813926..1814267 (+) | 342 | WP_227288564.1 | hypothetical protein | - |
| K5K97_RS09365 (K5K97_09360) | - | 1814270..1814638 (+) | 369 | WP_227289695.1 | DUF1064 domain-containing protein | - |
| K5K97_RS09370 (K5K97_09365) | - | 1814650..1815459 (+) | 810 | WP_227288565.1 | site-specific DNA-methyltransferase | - |
| K5K97_RS09375 (K5K97_09370) | - | 1815472..1815633 (+) | 162 | WP_227288566.1 | hypothetical protein | - |
| K5K97_RS09380 (K5K97_09375) | - | 1815646..1816329 (+) | 684 | WP_227288567.1 | helix-turn-helix transcriptional regulator | - |
| K5K97_RS09385 (K5K97_09380) | - | 1816467..1816622 (+) | 156 | WP_227288568.1 | hypothetical protein | - |
| K5K97_RS09390 (K5K97_09385) | - | 1816755..1816991 (+) | 237 | WP_227288569.1 | hypothetical protein | - |
| K5K97_RS09395 (K5K97_09390) | - | 1816995..1817408 (+) | 414 | WP_227288570.1 | integrase | - |
| K5K97_RS09400 (K5K97_09395) | - | 1817709..1818047 (+) | 339 | WP_227288571.1 | hypothetical protein | - |
| K5K97_RS09405 (K5K97_09400) | - | 1818363..1818590 (+) | 228 | WP_227288572.1 | hypothetical protein | - |
| K5K97_RS09410 (K5K97_09405) | - | 1818712..1819008 (+) | 297 | WP_227289697.1 | HNH endonuclease | - |
| K5K97_RS09415 (K5K97_09410) | - | 1819103..1819465 (+) | 363 | WP_227288573.1 | hypothetical protein | - |
| K5K97_RS09420 (K5K97_09415) | - | 1819458..1821152 (+) | 1695 | WP_227288574.1 | terminase large subunit | - |
| K5K97_RS09425 (K5K97_09420) | - | 1821298..1822341 (+) | 1044 | WP_227289699.1 | phage portal protein | - |
| K5K97_RS09430 (K5K97_09425) | - | 1822322..1822993 (+) | 672 | WP_227288575.1 | head maturation protease, ClpP-related | - |
| K5K97_RS09435 (K5K97_09430) | - | 1822993..1824135 (+) | 1143 | WP_227288576.1 | phage major capsid protein | - |
| K5K97_RS09440 (K5K97_09435) | - | 1824277..1824534 (+) | 258 | WP_227288577.1 | head-tail connector protein | - |
| K5K97_RS09445 (K5K97_09440) | - | 1824518..1824832 (+) | 315 | WP_227288578.1 | phage head closure protein | - |
| K5K97_RS09450 (K5K97_09445) | - | 1824822..1825157 (+) | 336 | WP_227288579.1 | hypothetical protein | - |
| K5K97_RS09455 (K5K97_09450) | - | 1825150..1825515 (+) | 366 | WP_227288580.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| K5K97_RS09460 (K5K97_09455) | - | 1825522..1826145 (+) | 624 | WP_227288581.1 | major tail protein | - |
| K5K97_RS09465 (K5K97_09460) | - | 1826145..1826615 (+) | 471 | WP_227288582.1 | hypothetical protein | - |
| K5K97_RS09470 (K5K97_09465) | - | 1826807..1829116 (+) | 2310 | WP_227288583.1 | phage tail tape measure protein | - |
| K5K97_RS09475 (K5K97_09470) | - | 1829116..1829832 (+) | 717 | WP_227288584.1 | phage tail protein | - |
| K5K97_RS09480 (K5K97_09475) | - | 1829829..1832495 (+) | 2667 | WP_227288585.1 | phage tail tip lysozyme | - |
| K5K97_RS09485 (K5K97_09480) | - | 1832508..1834673 (+) | 2166 | WP_227288586.1 | BppU family phage baseplate upper protein | - |
| K5K97_RS09490 (K5K97_09485) | - | 1834778..1835071 (+) | 294 | WP_227288587.1 | hypothetical protein | - |
| K5K97_RS09495 (K5K97_09490) | - | 1835071..1835268 (+) | 198 | WP_227288588.1 | phage holin | - |
| K5K97_RS14200 (K5K97_09495) | - | 1835322..1836158 (+) | 837 | WP_319796276.1 | SH3 domain-containing protein | - |
| K5K97_RS09510 (K5K97_09500) | - | 1836241..1836519 (-) | 279 | WP_227288589.1 | hypothetical protein | - |
| K5K97_RS09515 (K5K97_09505) | - | 1836986..1837234 (+) | 249 | WP_227288590.1 | hypothetical protein | - |
| K5K97_RS09520 (K5K97_09510) | - | 1837352..1837579 (+) | 228 | WP_227288591.1 | helix-turn-helix domain-containing protein | - |
| K5K97_RS09525 (K5K97_09515) | - | 1837560..1837910 (+) | 351 | WP_227288592.1 | hypothetical protein | - |
| K5K97_RS09530 (K5K97_09520) | - | 1838022..1838897 (+) | 876 | WP_167806177.1 | polysaccharide deacetylase family protein | - |
| K5K97_RS09535 (K5K97_09525) | - | 1839206..1840609 (+) | 1404 | WP_167799927.1 | PTS sugar transporter subunit IIC | - |
Sequence
Protein
Download Length: 155 a.a. Molecular weight: 17423.25 Da Isoelectric Point: 5.2337
>NTDB_id=596673 K5K97_RS09340 WP_227288560.1 1811582..1812049(+) (ssb) [Vagococcus fluvialis strain 25B2]
MINNVVLVGRLTRDPELKFTNNGSAVATFNLAVNRNFTNASGEREADFVNCVIWRKPAETLANYAKKGTLIGAVGRIQTR
NYENQEGRKVYVTEVVCDNFQLLESKKDNNQNNQQNNQSFHQDSMPGMDKRGFNNATDPFGQSSQIDISDDDLPF
MINNVVLVGRLTRDPELKFTNNGSAVATFNLAVNRNFTNASGEREADFVNCVIWRKPAETLANYAKKGTLIGAVGRIQTR
NYENQEGRKVYVTEVVCDNFQLLESKKDNNQNNQQNNQSFHQDSMPGMDKRGFNNATDPFGQSSQIDISDDDLPF
Nucleotide
Download Length: 468 bp
>NTDB_id=596673 K5K97_RS09340 WP_227288560.1 1811582..1812049(+) (ssb) [Vagococcus fluvialis strain 25B2]
ATGATTAACAACGTCGTACTAGTTGGTCGCTTAACTCGTGACCCAGAACTTAAATTTACTAACAATGGTTCGGCAGTGGC
AACTTTCAATCTAGCTGTTAACCGTAATTTTACAAATGCAAGTGGTGAGCGTGAAGCTGATTTTGTTAACTGCGTTATTT
GGAGGAAGCCTGCAGAAACTTTAGCTAATTATGCTAAGAAAGGTACTTTGATTGGTGCAGTCGGACGTATTCAGACGCGT
AACTATGAAAATCAGGAAGGAAGAAAAGTTTACGTCACAGAAGTAGTATGCGATAACTTCCAGTTATTAGAGTCTAAAAA
AGATAACAATCAGAATAACCAACAAAATAACCAATCGTTCCATCAAGATAGTATGCCAGGAATGGATAAAAGAGGTTTTA
ACAATGCTACTGATCCATTCGGACAAAGTAGTCAGATTGATATTTCAGATGACGATTTGCCGTTCTAA
ATGATTAACAACGTCGTACTAGTTGGTCGCTTAACTCGTGACCCAGAACTTAAATTTACTAACAATGGTTCGGCAGTGGC
AACTTTCAATCTAGCTGTTAACCGTAATTTTACAAATGCAAGTGGTGAGCGTGAAGCTGATTTTGTTAACTGCGTTATTT
GGAGGAAGCCTGCAGAAACTTTAGCTAATTATGCTAAGAAAGGTACTTTGATTGGTGCAGTCGGACGTATTCAGACGCGT
AACTATGAAAATCAGGAAGGAAGAAAAGTTTACGTCACAGAAGTAGTATGCGATAACTTCCAGTTATTAGAGTCTAAAAA
AGATAACAATCAGAATAACCAACAAAATAACCAATCGTTCCATCAAGATAGTATGCCAGGAATGGATAAAAGAGGTTTTA
ACAATGCTACTGATCCATTCGGACAAAGTAGTCAGATTGATATTTCAGATGACGATTTGCCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.619 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.892 |
100 |
0.619 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
68.387 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.565 |
84.516 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.802 |
84.516 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.802 |
84.516 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.802 |
84.516 |
0.387 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.802 |
84.516 |
0.387 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.802 |
84.516 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.511 |
84.516 |
0.368 |