Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SABB_RS08685 | Genome accession | NC_021670 |
| Coordinates | 1731510..1731821 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1726510..1736821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABB_RS08650 (SABB_03797) | gcvPA | 1727012..1728358 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SABB_RS08655 (SABB_00459) | gcvT | 1728378..1729469 (-) | 1092 | WP_000093351.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SABB_RS08660 (SABB_00460) | - | 1729628..1730152 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| SABB_RS08665 | - | 1730142..1730288 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SABB_RS08670 (SABB_06168) | comGF | 1730385..1730882 (-) | 498 | WP_001803317.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SABB_RS08675 (SABB_03576) | comGE | 1730800..1731099 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SABB_RS08680 (SABB_04962) | comGD | 1731086..1731532 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SABB_RS08685 (SABB_02848) | comGC | 1731510..1731821 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SABB_RS08690 (SABB_00465) | comGB | 1731835..1732905 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SABB_RS08695 (SABB_00466) | comGA | 1732877..1733851 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SABB_RS08700 (SABB_00467) | - | 1733903..1734526 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SABB_RS08705 (SABB_00468) | - | 1734523..1734852 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SABB_RS08710 (SABB_00469) | - | 1734852..1735838 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| SABB_RS08715 (SABB_06170) | - | 1735835..1736038 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=59471 SABB_RS08685 WP_000472256.1 1731510..1731821(-) (comGC) [Staphylococcus aureus]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=59471 SABB_RS08685 WP_000472256.1 1731510..1731821(-) (comGC) [Staphylococcus aureus]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |