Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KUO14_RS01940 | Genome accession | NZ_CP078015 |
| Coordinates | 383801..384259 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain SY-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 375389..434535 | 383801..384259 | within | 0 |
Gene organization within MGE regions
Location: 375389..434535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUO14_RS01875 (KUO14_01875) | prgU | 375942..376298 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| KUO14_RS01880 (KUO14_01880) | - | 376401..376706 (+) | 306 | WP_224567327.1 | hypothetical protein | - |
| KUO14_RS01885 (KUO14_01885) | - | 376852..377112 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| KUO14_RS01890 (KUO14_01890) | - | 377123..378001 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| KUO14_RS01895 (KUO14_01895) | - | 378021..378881 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| KUO14_RS01900 (KUO14_01900) | - | 378907..380177 (+) | 1271 | Protein_353 | CHAP domain-containing protein | - |
| KUO14_RS01905 (KUO14_01905) | - | 380180..380797 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| KUO14_RS01910 (KUO14_01910) | - | 380781..381197 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| KUO14_RS01915 (KUO14_01915) | - | 381197..381511 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| KUO14_RS01920 (KUO14_01920) | - | 381504..382538 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| KUO14_RS01925 (KUO14_01925) | - | 382543..382803 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| KUO14_RS01930 (KUO14_01930) | - | 382803..383192 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| KUO14_RS01935 (KUO14_01935) | - | 383224..383706 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| KUO14_RS01940 (KUO14_01940) | ssb | 383801..384259 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| KUO14_RS01945 (KUO14_01945) | - | 384364..386856 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| KUO14_RS01950 (KUO14_01950) | - | 386813..387211 (+) | 399 | WP_002370287.1 | DUF4923 family protein | - |
| KUO14_RS01955 (KUO14_01955) | - | 387224..389569 (+) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| KUO14_RS01960 (KUO14_01960) | - | 389556..391814 (+) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| KUO14_RS01965 (KUO14_01965) | - | 392337..393122 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| KUO14_RS01970 (KUO14_01970) | - | 393128..393616 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| KUO14_RS01975 (KUO14_01975) | - | 394208..394474 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| KUO14_RS01980 (KUO14_01980) | - | 394507..395007 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| KUO14_RS01985 (KUO14_01985) | - | 395020..395268 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| KUO14_RS01990 (KUO14_01990) | - | 395344..395760 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| KUO14_RS01995 (KUO14_01995) | - | 395784..396368 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| KUO14_RS02000 (KUO14_02000) | - | 396479..396745 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| KUO14_RS02005 (KUO14_02005) | - | 396738..397013 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| KUO14_RS02010 (KUO14_02010) | - | 397204..397848 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| KUO14_RS02015 (KUO14_02015) | - | 397981..398863 (+) | 883 | Protein_376 | IS256 family transposase | - |
| KUO14_RS02020 (KUO14_02020) | - | 399168..400205 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| KUO14_RS02025 (KUO14_02025) | - | 400231..401169 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| KUO14_RS02030 (KUO14_02030) | - | 401297..401566 (-) | 270 | Protein_379 | LPXTG cell wall anchor domain-containing protein | - |
| KUO14_RS02035 (KUO14_02035) | - | 401656..401841 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| KUO14_RS02040 (KUO14_02040) | - | 401873..402481 (+) | 609 | Protein_381 | IS6 family transposase | - |
| KUO14_RS02045 (KUO14_02045) | bsh | 403150..404124 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| KUO14_RS02050 (KUO14_02050) | - | 404348..404992 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| KUO14_RS02055 (KUO14_02055) | - | 405165..405479 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| KUO14_RS02060 (KUO14_02060) | cylR2 | 405817..406017 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| KUO14_RS02065 (KUO14_02065) | cylL-L | 406421..406627 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| KUO14_RS02070 (KUO14_02070) | cylL-S | 406661..406852 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| KUO14_RS02075 (KUO14_02075) | - | 406913..409894 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| KUO14_RS02080 (KUO14_02080) | - | 409906..412050 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| KUO14_RS02085 (KUO14_02085) | - | 412047..413285 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| KUO14_RS14300 | - | 413286..414269 (+) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| KUO14_RS02095 (KUO14_02095) | - | 414622..415185 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| KUO14_RS02100 (KUO14_02100) | - | 415622..416089 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| KUO14_RS02105 (KUO14_02105) | - | 416167..416748 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| KUO14_RS14305 | - | 416843..417049 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| KUO14_RS02110 (KUO14_02110) | amaP | 417319..417885 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| KUO14_RS02115 (KUO14_02115) | - | 417902..418093 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| KUO14_RS02120 (KUO14_02120) | - | 418122..418658 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| KUO14_RS02125 (KUO14_02125) | - | 418934..424555 (+) | 5622 | WP_202289641.1 | Rib/alpha-like domain-containing protein | - |
| KUO14_RS02130 (KUO14_02130) | - | 424755..425963 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| KUO14_RS02135 (KUO14_02135) | - | 426093..426509 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| KUO14_RS02140 (KUO14_02140) | - | 426645..426746 (-) | 102 | Protein_402 | IS30 family transposase | - |
| KUO14_RS02145 (KUO14_02145) | - | 426734..427471 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| KUO14_RS02150 (KUO14_02150) | - | 427517..428137 (-) | 621 | WP_033591050.1 | recombinase family protein | - |
| KUO14_RS02155 (KUO14_02155) | - | 428321..428940 (+) | 620 | Protein_405 | recombinase family protein | - |
| KUO14_RS02160 (KUO14_02160) | - | 429687..430505 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| KUO14_RS02165 (KUO14_02165) | - | 430661..431368 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| KUO14_RS02170 (KUO14_02170) | - | 431361..432863 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| KUO14_RS02175 (KUO14_02175) | - | 432874..433356 (+) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=586314 KUO14_RS01940 WP_002365911.1 383801..384259(+) (ssb) [Enterococcus faecalis strain SY-1]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=586314 KUO14_RS01940 WP_002365911.1 383801..384259(+) (ssb) [Enterococcus faecalis strain SY-1]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |