Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | KI234_RS08010 | Genome accession | NZ_CP076027 |
| Coordinates | 1646822..1647133 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. MZ7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1641822..1652133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI234_RS07975 (KI234_07975) | gcvPA | 1642324..1643670 (-) | 1347 | WP_045177127.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| KI234_RS07980 (KI234_07980) | gcvT | 1643690..1644781 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KI234_RS07985 (KI234_07985) | - | 1644940..1645464 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| KI234_RS07990 (KI234_07990) | - | 1645454..1645600 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| KI234_RS07995 (KI234_07995) | comGF | 1645697..1646194 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KI234_RS08000 (KI234_08000) | comGE | 1646112..1646411 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| KI234_RS08005 (KI234_08005) | comGD | 1646398..1646844 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KI234_RS08010 (KI234_08010) | comGC | 1646822..1647133 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KI234_RS08015 (KI234_08015) | comGB | 1647147..1648217 (-) | 1071 | WP_045176802.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KI234_RS08020 (KI234_08020) | comGA | 1648189..1649163 (-) | 975 | WP_000697227.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| KI234_RS08025 (KI234_08025) | - | 1649215..1649838 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| KI234_RS08030 (KI234_08030) | - | 1649835..1650164 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| KI234_RS08035 (KI234_08035) | - | 1650164..1651150 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| KI234_RS08040 (KI234_08040) | - | 1651147..1651350 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=571466 KI234_RS08010 WP_000472256.1 1646822..1647133(-) (comGC) [Staphylococcus sp. MZ7]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=571466 KI234_RS08010 WP_000472256.1 1646822..1647133(-) (comGC) [Staphylococcus sp. MZ7]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |