Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | KI230_RS07715 | Genome accession | NZ_CP076026 |
| Coordinates | 1609052..1609363 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. MZ3 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1604052..1614363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI230_RS07680 (KI230_07680) | gcvPA | 1604554..1605900 (-) | 1347 | WP_045177127.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| KI230_RS07685 (KI230_07685) | gcvT | 1605920..1607011 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KI230_RS07690 (KI230_07690) | - | 1607170..1607694 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| KI230_RS07695 (KI230_07695) | - | 1607684..1607830 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| KI230_RS07700 (KI230_07700) | comGF | 1607927..1608424 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KI230_RS07705 (KI230_07705) | comGE | 1608342..1608641 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| KI230_RS07710 (KI230_07710) | comGD | 1608628..1609074 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KI230_RS07715 (KI230_07715) | comGC | 1609052..1609363 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KI230_RS07720 (KI230_07720) | comGB | 1609377..1610447 (-) | 1071 | WP_045176802.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KI230_RS07725 (KI230_07725) | comGA | 1610419..1611393 (-) | 975 | WP_000697227.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| KI230_RS07730 (KI230_07730) | - | 1611445..1612068 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| KI230_RS07735 (KI230_07735) | - | 1612065..1612394 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| KI230_RS07740 (KI230_07740) | - | 1612394..1613380 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| KI230_RS07745 (KI230_07745) | - | 1613377..1613580 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=571424 KI230_RS07715 WP_000472256.1 1609052..1609363(-) (comGC) [Staphylococcus sp. MZ3]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=571424 KI230_RS07715 WP_000472256.1 1609052..1609363(-) (comGC) [Staphylococcus sp. MZ3]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |