Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | KI229_RS07680 | Genome accession | NZ_CP076025 |
| Coordinates | 1596372..1596683 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. MZ1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1591372..1601683
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI229_RS07645 (KI229_07645) | gcvPA | 1591874..1593220 (-) | 1347 | WP_045177127.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| KI229_RS07650 (KI229_07650) | gcvT | 1593240..1594331 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KI229_RS07655 (KI229_07655) | - | 1594490..1595014 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| KI229_RS07660 (KI229_07660) | - | 1595004..1595150 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| KI229_RS07665 (KI229_07665) | comGF | 1595247..1595744 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KI229_RS07670 (KI229_07670) | comGE | 1595662..1595961 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| KI229_RS07675 (KI229_07675) | comGD | 1595948..1596394 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KI229_RS07680 (KI229_07680) | comGC | 1596372..1596683 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KI229_RS07685 (KI229_07685) | comGB | 1596697..1597767 (-) | 1071 | WP_045176802.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KI229_RS07690 (KI229_07690) | comGA | 1597739..1598713 (-) | 975 | WP_000697227.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| KI229_RS07695 (KI229_07695) | - | 1598765..1599388 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| KI229_RS07700 (KI229_07700) | - | 1599385..1599714 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| KI229_RS07705 (KI229_07705) | - | 1599714..1600700 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| KI229_RS07710 (KI229_07710) | - | 1600697..1600900 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=571382 KI229_RS07680 WP_000472256.1 1596372..1596683(-) (comGC) [Staphylococcus sp. MZ1]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=571382 KI229_RS07680 WP_000472256.1 1596372..1596683(-) (comGC) [Staphylococcus sp. MZ1]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |