Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | J7S31_RS05745 | Genome accession | NZ_CP072523 |
| Coordinates | 1149542..1149724 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain SHZ-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1149542..1191053 | 1149542..1149724 | within | 0 |
Gene organization within MGE regions
Location: 1149542..1191053
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7S31_RS05745 (J7S31_05730) | prx | 1149542..1149724 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| J7S31_RS05750 | - | 1149789..1150076 (-) | 288 | WP_011106694.1 | hypothetical protein | - |
| J7S31_RS05755 (J7S31_05735) | - | 1150070..1150645 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| J7S31_RS05760 (J7S31_05740) | spek | 1151121..1151900 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| J7S31_RS05765 (J7S31_05745) | - | 1152204..1153070 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| J7S31_RS05770 (J7S31_05750) | - | 1153058..1153582 (-) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| J7S31_RS05775 (J7S31_05755) | - | 1153722..1154924 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| J7S31_RS05780 (J7S31_05760) | - | 1155035..1155220 (-) | 186 | WP_011054731.1 | holin | - |
| J7S31_RS05785 (J7S31_05765) | - | 1155217..1155513 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| J7S31_RS05790 (J7S31_05770) | - | 1155524..1156135 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| J7S31_RS05795 (J7S31_05775) | - | 1156138..1156569 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| J7S31_RS05800 (J7S31_05780) | - | 1156581..1158464 (-) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| J7S31_RS05805 (J7S31_05785) | hylP | 1158479..1159492 (-) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| J7S31_RS05810 (J7S31_05790) | - | 1159489..1161633 (-) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| J7S31_RS05815 (J7S31_05795) | - | 1161630..1162346 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| J7S31_RS05820 (J7S31_05800) | - | 1162343..1165603 (-) | 3261 | WP_011054738.1 | tape measure protein | - |
| J7S31_RS05825 (J7S31_05805) | - | 1165593..1166174 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| J7S31_RS05830 (J7S31_05810) | - | 1166178..1166612 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| J7S31_RS05835 (J7S31_05815) | - | 1166651..1167136 (-) | 486 | WP_011054741.1 | hypothetical protein | - |
| J7S31_RS05840 (J7S31_05820) | - | 1167136..1167534 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| J7S31_RS05845 (J7S31_05825) | - | 1167531..1167887 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| J7S31_RS05850 (J7S31_05830) | - | 1167887..1168219 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| J7S31_RS05855 (J7S31_05835) | - | 1168209..1168625 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| J7S31_RS05860 (J7S31_05840) | - | 1168679..1169497 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| J7S31_RS05865 (J7S31_05845) | - | 1169501..1170115 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| J7S31_RS05870 (J7S31_05850) | - | 1170241..1170507 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| J7S31_RS05875 (J7S31_05855) | - | 1170569..1170808 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| J7S31_RS05880 (J7S31_05860) | - | 1170780..1172258 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| J7S31_RS05885 (J7S31_05865) | - | 1172263..1173765 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| J7S31_RS05890 (J7S31_05870) | - | 1173779..1174990 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| J7S31_RS05895 (J7S31_05875) | - | 1175073..1175546 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| J7S31_RS05900 (J7S31_05880) | - | 1175597..1175974 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| J7S31_RS05905 (J7S31_05885) | - | 1176035..1176511 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| J7S31_RS05910 (J7S31_05890) | - | 1176427..1177104 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| J7S31_RS05915 (J7S31_05895) | - | 1177083..1177601 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| J7S31_RS05920 (J7S31_05900) | - | 1177682..1177939 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| J7S31_RS05925 (J7S31_05905) | - | 1178578..1179018 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| J7S31_RS05930 (J7S31_05910) | - | 1179292..1179462 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| J7S31_RS05935 (J7S31_05915) | - | 1179459..1179965 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| J7S31_RS05940 (J7S31_05920) | - | 1179962..1180132 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| J7S31_RS05945 (J7S31_05925) | - | 1180129..1180533 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| J7S31_RS05950 (J7S31_05930) | - | 1180543..1180812 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| J7S31_RS05955 (J7S31_05935) | - | 1180809..1181093 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| J7S31_RS05960 (J7S31_05940) | - | 1181087..1181338 (-) | 252 | WP_032461848.1 | hypothetical protein | - |
| J7S31_RS05965 (J7S31_05945) | - | 1181335..1181691 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| J7S31_RS05970 (J7S31_05950) | - | 1181688..1182128 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| J7S31_RS05975 (J7S31_05955) | - | 1182128..1182331 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| J7S31_RS05980 (J7S31_05960) | ssbA | 1182337..1182756 (-) | 420 | WP_032464069.1 | single-stranded DNA-binding protein | Machinery gene |
| J7S31_RS05985 (J7S31_05965) | - | 1182749..1183423 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| J7S31_RS05990 (J7S31_05970) | - | 1183424..1183906 (-) | 483 | WP_240788764.1 | siphovirus Gp157 family protein | - |
| J7S31_RS05995 (J7S31_05975) | - | 1183928..1184182 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| J7S31_RS06000 (J7S31_05980) | - | 1184193..1184333 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| J7S31_RS06005 (J7S31_05985) | - | 1184330..1184563 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| J7S31_RS06010 (J7S31_05990) | - | 1184544..1184957 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| J7S31_RS06015 (J7S31_05995) | - | 1185079..1185336 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| J7S31_RS06020 (J7S31_06000) | - | 1185430..1185615 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| J7S31_RS06025 (J7S31_06005) | - | 1185644..1185901 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| J7S31_RS06030 (J7S31_06010) | - | 1186147..1186314 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| J7S31_RS06035 (J7S31_06015) | - | 1186390..1186590 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| J7S31_RS06040 (J7S31_06020) | - | 1186587..1186736 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| J7S31_RS06045 (J7S31_06025) | - | 1186769..1187497 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| J7S31_RS06050 (J7S31_06030) | - | 1187508..1187699 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| J7S31_RS06055 (J7S31_06035) | - | 1188495..1188854 (+) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS06060 (J7S31_06040) | - | 1188868..1189248 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| J7S31_RS06065 (J7S31_06045) | - | 1189259..1189780 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| J7S31_RS06070 (J7S31_06050) | - | 1189956..1191053 (+) | 1098 | WP_015967409.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=553871 J7S31_RS05745 WP_011054726.1 1149542..1149724(-) (prx) [Streptococcus pyogenes strain SHZ-1]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=553871 J7S31_RS05745 WP_011054726.1 1149542..1149724(-) (prx) [Streptococcus pyogenes strain SHZ-1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |