Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | J7S31_RS06240 | Genome accession | NZ_CP072523 |
| Coordinates | 1232520..1232702 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain SHZ-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1232520..1270487 | 1232520..1232702 | within | 0 |
Gene organization within MGE regions
Location: 1232520..1270487
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7S31_RS06240 (J7S31_06220) | prx | 1232520..1232702 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| J7S31_RS06245 (J7S31_06225) | speA | 1232922..1233677 (+) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| J7S31_RS06250 (J7S31_06230) | - | 1233799..1234458 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| J7S31_RS06255 (J7S31_06235) | - | 1234458..1234679 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| J7S31_RS06260 (J7S31_06240) | - | 1234689..1235462 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| J7S31_RS06265 (J7S31_06245) | - | 1235473..1236075 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| J7S31_RS06270 (J7S31_06250) | - | 1236087..1236851 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| J7S31_RS06275 (J7S31_06255) | - | 1236853..1237185 (-) | 333 | WP_011054798.1 | phage holin | - |
| J7S31_RS09195 | - | 1237521..1237643 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| J7S31_RS06280 (J7S31_06260) | - | 1237657..1238004 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| J7S31_RS06285 (J7S31_06265) | - | 1238015..1239877 (-) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| J7S31_RS06290 (J7S31_06270) | - | 1239882..1243322 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| J7S31_RS06295 (J7S31_06275) | - | 1243323..1244807 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| J7S31_RS06300 (J7S31_06280) | - | 1244808..1246613 (-) | 1806 | WP_011054802.1 | tail protein | - |
| J7S31_RS06305 (J7S31_06285) | - | 1246606..1247064 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| J7S31_RS06310 (J7S31_06290) | - | 1247037..1247354 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| J7S31_RS06315 (J7S31_06295) | - | 1247367..1247873 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| J7S31_RS06320 (J7S31_06300) | - | 1247885..1248295 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| J7S31_RS06325 (J7S31_06305) | - | 1248297..1248692 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| J7S31_RS06330 (J7S31_06310) | - | 1248689..1249000 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| J7S31_RS06335 (J7S31_06315) | - | 1248997..1249341 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| J7S31_RS06340 (J7S31_06320) | - | 1249355..1249648 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| J7S31_RS06345 (J7S31_06325) | - | 1249661..1250551 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| J7S31_RS06350 (J7S31_06330) | - | 1250569..1251141 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| J7S31_RS06355 (J7S31_06335) | - | 1251291..1251557 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| J7S31_RS06360 (J7S31_06340) | - | 1251564..1252472 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| J7S31_RS06365 (J7S31_06345) | - | 1252441..1253766 (-) | 1326 | WP_032461413.1 | phage portal protein | - |
| J7S31_RS06370 (J7S31_06350) | - | 1253766..1255040 (-) | 1275 | Protein_1216 | PBSX family phage terminase large subunit | - |
| J7S31_RS06375 (J7S31_06355) | - | 1255030..1255410 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| J7S31_RS06380 (J7S31_06360) | - | 1256020..1256454 (-) | 435 | WP_240788765.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| J7S31_RS06385 (J7S31_06365) | - | 1256738..1256908 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| J7S31_RS06390 (J7S31_06370) | - | 1256905..1257408 (-) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| J7S31_RS06395 (J7S31_06375) | - | 1257695..1257880 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| J7S31_RS06400 (J7S31_06380) | - | 1258046..1258381 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| J7S31_RS06405 (J7S31_06385) | - | 1258384..1258668 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| J7S31_RS06410 (J7S31_06390) | - | 1258665..1258835 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| J7S31_RS06415 (J7S31_06395) | - | 1258832..1259245 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| J7S31_RS06420 (J7S31_06400) | - | 1259242..1259526 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| J7S31_RS09235 | - | 1259520..1259771 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| J7S31_RS06425 (J7S31_06405) | - | 1259768..1260124 (-) | 357 | WP_011054816.1 | hypothetical protein | - |
| J7S31_RS06430 (J7S31_06410) | - | 1260108..1260428 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| J7S31_RS06435 (J7S31_06415) | - | 1260673..1262153 (-) | 1481 | Protein_1230 | phage/plasmid primase, P4 family | - |
| J7S31_RS06445 (J7S31_06420) | - | 1262143..1262955 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| J7S31_RS06450 (J7S31_06425) | - | 1262958..1263416 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| J7S31_RS06455 (J7S31_06430) | - | 1263432..1264661 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| J7S31_RS06460 (J7S31_06435) | - | 1264763..1265443 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| J7S31_RS06465 (J7S31_06440) | - | 1265444..1265926 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| J7S31_RS06470 (J7S31_06445) | - | 1266155..1266469 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS06475 (J7S31_06450) | - | 1266485..1266622 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| J7S31_RS06480 (J7S31_06455) | - | 1266653..1266904 (-) | 252 | WP_011054822.1 | hypothetical protein | - |
| J7S31_RS06485 (J7S31_06460) | - | 1266977..1267216 (-) | 240 | WP_050428444.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS06490 (J7S31_06465) | - | 1267405..1267764 (+) | 360 | WP_011054823.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS06495 (J7S31_06470) | - | 1267748..1268125 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| J7S31_RS06500 (J7S31_06475) | - | 1268136..1268288 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| J7S31_RS06505 (J7S31_06480) | - | 1268557..1269147 (+) | 591 | WP_009880743.1 | hypothetical protein | - |
| J7S31_RS06510 (J7S31_06485) | - | 1269321..1270487 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=553873 J7S31_RS06240 WP_011054793.1 1232520..1232702(-) (prx) [Streptococcus pyogenes strain SHZ-1]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=553873 J7S31_RS06240 WP_011054793.1 1232520..1232702(-) (prx) [Streptococcus pyogenes strain SHZ-1]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |