Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JZP79_RS01870 | Genome accession | NZ_CP071176 |
| Coordinates | 353747..354205 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain L18 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 341050..385829 | 353747..354205 | within | 0 |
Gene organization within MGE regions
Location: 341050..385829
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZP79_RS01800 (JZP79_01800) | - | 341920..345825 (+) | 3906 | WP_002370235.1 | LPXTG-anchored aggregation substance | - |
| JZP79_RS01805 (JZP79_01805) | prgU | 345887..346243 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| JZP79_RS01810 (JZP79_01810) | - | 346265..346651 (+) | 387 | WP_002364326.1 | hypothetical protein | - |
| JZP79_RS01815 (JZP79_01815) | - | 346797..347057 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| JZP79_RS01820 (JZP79_01820) | - | 347068..347946 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| JZP79_RS01825 (JZP79_01825) | - | 347966..348826 (+) | 861 | WP_153246783.1 | LPXTG cell wall anchor domain-containing protein | - |
| JZP79_RS01830 (JZP79_01830) | - | 348852..350123 (+) | 1272 | WP_071981423.1 | CHAP domain-containing protein | - |
| JZP79_RS01835 (JZP79_01835) | - | 350126..350743 (+) | 618 | WP_071981424.1 | hypothetical protein | - |
| JZP79_RS01840 (JZP79_01840) | - | 350727..351143 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| JZP79_RS01845 (JZP79_01845) | - | 351143..351457 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| JZP79_RS01850 (JZP79_01850) | - | 351450..352484 (+) | 1035 | WP_002385553.1 | conjugal transfer protein | - |
| JZP79_RS01855 (JZP79_01855) | - | 352489..352749 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| JZP79_RS01860 (JZP79_01860) | - | 352749..353138 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| JZP79_RS01865 (JZP79_01865) | - | 353170..353652 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| JZP79_RS01870 (JZP79_01870) | ssb | 353747..354205 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| JZP79_RS01875 (JZP79_01875) | - | 354310..356802 (+) | 2493 | WP_071981425.1 | ATP-binding protein | - |
| JZP79_RS01880 (JZP79_01880) | - | 356759..357157 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| JZP79_RS01885 (JZP79_01885) | - | 357170..359515 (+) | 2346 | WP_002415816.1 | CD3337/EF1877 family mobilome membrane protein | - |
| JZP79_RS01890 (JZP79_01890) | - | 359502..361760 (+) | 2259 | WP_002415815.1 | type IV secretory system conjugative DNA transfer family protein | - |
| JZP79_RS01895 (JZP79_01895) | - | 362283..363068 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| JZP79_RS01900 (JZP79_01900) | - | 363074..363562 (+) | 489 | WP_002415813.1 | hypothetical protein | - |
| JZP79_RS01905 (JZP79_01905) | - | 364154..364420 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| JZP79_RS01910 (JZP79_01910) | - | 364453..364953 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| JZP79_RS01915 (JZP79_01915) | - | 364966..365214 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| JZP79_RS01920 (JZP79_01920) | - | 365290..365706 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| JZP79_RS01925 (JZP79_01925) | - | 365730..366314 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| JZP79_RS01930 (JZP79_01930) | - | 366425..366691 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| JZP79_RS01935 (JZP79_01935) | - | 366684..366959 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| JZP79_RS01940 (JZP79_01940) | - | 367150..367830 (-) | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| JZP79_RS01945 (JZP79_01945) | - | 367998..368606 (+) | 609 | WP_002361211.1 | response regulator transcription factor | - |
| JZP79_RS01950 (JZP79_01950) | - | 369034..369909 (+) | 876 | WP_002390484.1 | aldo/keto reductase | - |
| JZP79_RS01955 (JZP79_01955) | - | 369932..370414 (+) | 483 | WP_002397525.1 | VOC family protein | - |
| JZP79_RS01960 (JZP79_01960) | cls | 370580..372025 (+) | 1446 | WP_002361214.1 | cardiolipin synthase | - |
| JZP79_RS01965 (JZP79_01965) | tyrS | 372723..373979 (+) | 1257 | WP_002355444.1 | tyrosine--tRNA ligase | - |
| JZP79_RS01970 (JZP79_01970) | tdc | 374278..376140 (+) | 1863 | WP_002355450.1 | tyrosine decarboxylase | - |
| JZP79_RS01975 (JZP79_01975) | tyrP | 376343..377761 (+) | 1419 | WP_002355453.1 | tyrosine-tyramine antiporter | - |
| JZP79_RS01980 (JZP79_01980) | nhaC | 377886..379292 (+) | 1407 | WP_002397523.1 | Na+/H+ antiporter NhaC | - |
| JZP79_RS01985 (JZP79_01985) | - | 379648..380565 (+) | 918 | WP_002397522.1 | hypothetical protein | - |
| JZP79_RS01990 (JZP79_01990) | - | 380618..381067 (-) | 450 | WP_002355456.1 | YehR family lipoprotein | - |
| JZP79_RS01995 (JZP79_01995) | - | 381206..381712 (-) | 507 | WP_002355457.1 | phosphatidylglycerophosphatase A | - |
| JZP79_RS02000 (JZP79_02000) | - | 381844..382797 (-) | 954 | WP_002358635.1 | L-lactate dehydrogenase | - |
| JZP79_RS02005 (JZP79_02005) | - | 382965..383327 (+) | 363 | WP_002363122.1 | DUF4809 family protein | - |
| JZP79_RS02010 (JZP79_02010) | - | 383343..383753 (+) | 411 | WP_002358638.1 | DUF4809 family protein | - |
| JZP79_RS02015 (JZP79_02015) | - | 383800..384627 (-) | 828 | WP_002371452.1 | LysR family transcriptional regulator | - |
| JZP79_RS02020 (JZP79_02020) | - | 384769..385737 (+) | 969 | WP_002355462.1 | TDT family transporter | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=543452 JZP79_RS01870 WP_002365911.1 353747..354205(+) (ssb) [Enterococcus faecalis strain L18]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=543452 JZP79_RS01870 WP_002365911.1 353747..354205(+) (ssb) [Enterococcus faecalis strain L18]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |