Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JZP77_RS11605 | Genome accession | NZ_CP071172 |
| Coordinates | 2413708..2414166 (-) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain L13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2359615..2414510 | 2413708..2414166 | within | 0 |
Gene organization within MGE regions
Location: 2359615..2414510
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZP77_RS11335 (JZP77_11335) | - | 2359813..2360547 (-) | 735 | WP_002378008.1 | pseudouridine synthase | - |
| JZP77_RS11340 (JZP77_11340) | - | 2360656..2362305 (-) | 1650 | WP_002364837.1 | putative polysaccharide biosynthesis protein | - |
| JZP77_RS11345 (JZP77_11345) | - | 2362509..2364035 (+) | 1527 | WP_002378005.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase | - |
| JZP77_RS11350 (JZP77_11350) | - | 2364102..2364674 (-) | 573 | WP_002358653.1 | alpha/beta hydrolase | - |
| JZP77_RS11355 (JZP77_11355) | - | 2364705..2365679 (+) | 975 | WP_002361234.1 | ring-cleaving dioxygenase | - |
| JZP77_RS11360 (JZP77_11360) | - | 2365792..2365965 (+) | 174 | WP_002355495.1 | hypothetical protein | - |
| JZP77_RS11365 (JZP77_11365) | - | 2366041..2366511 (-) | 471 | WP_002384891.1 | C-GCAxxG-C-C family protein | - |
| JZP77_RS11370 (JZP77_11370) | - | 2366564..2367292 (-) | 729 | WP_002361233.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| JZP77_RS11375 (JZP77_11375) | - | 2367422..2367931 (-) | 510 | WP_002366143.1 | VanZ family protein | - |
| JZP77_RS11380 (JZP77_11380) | - | 2368059..2369885 (+) | 1827 | WP_002401859.1 | M3 family oligoendopeptidase | - |
| JZP77_RS11385 (JZP77_11385) | - | 2369910..2371250 (-) | 1341 | WP_002366141.1 | MATE family efflux transporter | - |
| JZP77_RS11390 (JZP77_11390) | - | 2371425..2372075 (-) | 651 | WP_002378001.1 | uracil-DNA glycosylase | - |
| JZP77_RS11395 (JZP77_11395) | - | 2372162..2373562 (-) | 1401 | WP_002394655.1 | aminopeptidase P family protein | - |
| JZP77_RS11400 (JZP77_11400) | - | 2373575..2374336 (-) | 762 | WP_002415143.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| JZP77_RS11405 (JZP77_11405) | - | 2374465..2375310 (-) | 846 | WP_010713915.1 | VOC family protein | - |
| JZP77_RS11410 (JZP77_11410) | - | 2375353..2375949 (-) | 597 | WP_002355475.1 | nitroreductase family protein | - |
| JZP77_RS11415 (JZP77_11415) | - | 2376120..2377055 (-) | 936 | WP_002361227.1 | LacI family DNA-binding transcriptional regulator | - |
| JZP77_RS11420 (JZP77_11420) | - | 2377060..2377344 (-) | 285 | WP_002382953.1 | hypothetical protein | - |
| JZP77_RS11425 (JZP77_11425) | - | 2377460..2377795 (+) | 336 | WP_002358645.1 | hypothetical protein | - |
| JZP77_RS11430 (JZP77_11430) | - | 2377978..2378832 (+) | 855 | WP_002415141.1 | M48 family metallopeptidase | - |
| JZP77_RS11435 (JZP77_11435) | - | 2378903..2379916 (-) | 1014 | WP_010713918.1 | lipoate--protein ligase | - |
| JZP77_RS11440 (JZP77_11440) | - | 2380103..2380720 (-) | 618 | WP_002355466.1 | nitroreductase family protein | - |
| JZP77_RS11445 (JZP77_11445) | - | 2380832..2381179 (+) | 348 | WP_002355464.1 | winged helix-turn-helix transcriptional regulator | - |
| JZP77_RS11450 (JZP77_11450) | - | 2381193..2382152 (-) | 960 | WP_002371454.1 | GDP-mannose 4,6-dehydratase | - |
| JZP77_RS11455 (JZP77_11455) | - | 2382176..2383144 (-) | 969 | WP_002355462.1 | TDT family transporter | - |
| JZP77_RS11460 (JZP77_11460) | - | 2383286..2384113 (+) | 828 | WP_002371452.1 | LysR family transcriptional regulator | - |
| JZP77_RS11465 (JZP77_11465) | - | 2384160..2384570 (-) | 411 | WP_002358638.1 | DUF4809 family protein | - |
| JZP77_RS11470 (JZP77_11470) | - | 2384586..2384948 (-) | 363 | WP_002363122.1 | DUF4809 family protein | - |
| JZP77_RS11475 (JZP77_11475) | - | 2385116..2386069 (+) | 954 | WP_002358635.1 | L-lactate dehydrogenase | - |
| JZP77_RS11480 (JZP77_11480) | - | 2386201..2386707 (+) | 507 | WP_002355457.1 | phosphatidylglycerophosphatase A | - |
| JZP77_RS11485 (JZP77_11485) | - | 2386846..2387295 (+) | 450 | WP_002355456.1 | YehR family lipoprotein | - |
| JZP77_RS11490 (JZP77_11490) | - | 2387348..2388265 (-) | 918 | WP_002397522.1 | hypothetical protein | - |
| JZP77_RS11495 (JZP77_11495) | nhaC | 2388621..2390027 (-) | 1407 | WP_002397523.1 | Na+/H+ antiporter NhaC | - |
| JZP77_RS11500 (JZP77_11500) | tyrP | 2390152..2391570 (-) | 1419 | WP_002355453.1 | tyrosine-tyramine antiporter | - |
| JZP77_RS11505 (JZP77_11505) | tdc | 2391773..2393635 (-) | 1863 | WP_002355450.1 | tyrosine decarboxylase | - |
| JZP77_RS11510 (JZP77_11510) | tyrS | 2393934..2395190 (-) | 1257 | WP_002355444.1 | tyrosine--tRNA ligase | - |
| JZP77_RS11515 (JZP77_11515) | cls | 2395888..2397333 (-) | 1446 | WP_002361214.1 | cardiolipin synthase | - |
| JZP77_RS11520 (JZP77_11520) | - | 2397499..2397981 (-) | 483 | WP_002397525.1 | VOC family protein | - |
| JZP77_RS11525 (JZP77_11525) | - | 2398004..2398879 (-) | 876 | WP_002390484.1 | aldo/keto reductase | - |
| JZP77_RS11530 (JZP77_11530) | - | 2399307..2399915 (-) | 609 | WP_002361211.1 | response regulator transcription factor | - |
| JZP77_RS11535 (JZP77_11535) | - | 2400083..2400763 (+) | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| JZP77_RS11540 (JZP77_11540) | - | 2400954..2401229 (-) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| JZP77_RS11545 (JZP77_11545) | - | 2401222..2401488 (-) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| JZP77_RS11550 (JZP77_11550) | - | 2401599..2402183 (-) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| JZP77_RS11555 (JZP77_11555) | - | 2402207..2402623 (-) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| JZP77_RS11560 (JZP77_11560) | - | 2402699..2402947 (-) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| JZP77_RS11565 (JZP77_11565) | - | 2402960..2403460 (-) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| JZP77_RS11570 (JZP77_11570) | - | 2403493..2403759 (-) | 267 | WP_002377947.1 | hypothetical protein | - |
| JZP77_RS11575 (JZP77_11575) | - | 2404351..2404839 (-) | 489 | WP_002415813.1 | hypothetical protein | - |
| JZP77_RS11580 (JZP77_11580) | - | 2404845..2405630 (-) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| JZP77_RS11585 (JZP77_11585) | - | 2406153..2408411 (-) | 2259 | WP_002415815.1 | type IV secretory system conjugative DNA transfer family protein | - |
| JZP77_RS11590 (JZP77_11590) | - | 2408398..2410743 (-) | 2346 | WP_002415816.1 | CD3337/EF1877 family mobilome membrane protein | - |
| JZP77_RS11595 (JZP77_11595) | - | 2410756..2411154 (-) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| JZP77_RS11600 (JZP77_11600) | - | 2411111..2413603 (-) | 2493 | WP_071981425.1 | ATP-binding protein | - |
| JZP77_RS11605 (JZP77_11605) | ssb | 2413708..2414166 (-) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=543443 JZP77_RS11605 WP_002365911.1 2413708..2414166(-) (ssb) [Enterococcus faecalis strain L13]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=543443 JZP77_RS11605 WP_002365911.1 2413708..2414166(-) (ssb) [Enterococcus faecalis strain L13]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |