Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | JQM34_RS06875 | Genome accession | NZ_CP069427 |
| Coordinates | 1439979..1440104 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain SF100 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1434979..1445104
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JQM34_RS06850 (JQM34_0001397) | dnaA | 1435442..1436803 (-) | 1362 | WP_000660625.1 | chromosomal replication initiator protein DnaA | - |
| JQM34_RS06855 (JQM34_0001398) | spo0J | 1437020..1437778 (-) | 759 | WP_200370607.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| JQM34_RS06860 (JQM34_0001399) | htrA | 1437836..1439032 (-) | 1197 | WP_000681800.1 | S1C family serine protease | Regulator |
| JQM34_RS06865 (JQM34_0001400) | rlmH | 1439218..1439697 (+) | 480 | WP_200370609.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| JQM34_RS06875 (JQM34_0001402) | comC/comC2 | 1439979..1440104 (+) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| JQM34_RS06880 (JQM34_0001403) | comD | 1440125..1441444 (+) | 1320 | WP_000362886.1 | competence system sensor histidine kinase ComD | Regulator |
| JQM34_RS06885 (JQM34_0001404) | comE | 1441441..1442193 (+) | 753 | WP_200370611.1 | competence system response regulator transcription factor ComE | Regulator |
| JQM34_RS06900 (JQM34_0001407) | - | 1442431..1442973 (-) | 543 | WP_000665080.1 | TetR-like C-terminal domain-containing protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=534545 JQM34_RS06875 WP_000799678.1 1439979..1440104(+) (comC/comC2) [Streptococcus oralis strain SF100]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=534545 JQM34_RS06875 WP_000799678.1 1439979..1440104(+) (comC/comC2) [Streptococcus oralis strain SF100]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |