Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JO410_RS02230 | Genome accession | NZ_CP069185 |
| Coordinates | 432944..433402 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain L11 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 420247..465026 | 432944..433402 | within | 0 |
Gene organization within MGE regions
Location: 420247..465026
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JO410_RS02160 (JO410_02160) | - | 421117..425022 (+) | 3906 | WP_002370235.1 | LPXTG-anchored aggregation substance | - |
| JO410_RS02165 (JO410_02165) | prgU | 425084..425440 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| JO410_RS02170 (JO410_02170) | - | 425462..425848 (+) | 387 | WP_002364326.1 | hypothetical protein | - |
| JO410_RS02175 (JO410_02175) | - | 425994..426254 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| JO410_RS02180 (JO410_02180) | - | 426265..427143 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| JO410_RS02185 (JO410_02185) | - | 427163..428023 (+) | 861 | WP_153246783.1 | LPXTG cell wall anchor domain-containing protein | - |
| JO410_RS02190 (JO410_02190) | - | 428049..429320 (+) | 1272 | WP_071981423.1 | CHAP domain-containing protein | - |
| JO410_RS02195 (JO410_02195) | - | 429323..429940 (+) | 618 | WP_071981424.1 | hypothetical protein | - |
| JO410_RS02200 (JO410_02200) | - | 429924..430340 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| JO410_RS02205 (JO410_02205) | - | 430340..430654 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| JO410_RS02210 (JO410_02210) | - | 430647..431681 (+) | 1035 | WP_002385553.1 | conjugal transfer protein | - |
| JO410_RS02215 (JO410_02215) | - | 431686..431946 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| JO410_RS02220 (JO410_02220) | - | 431946..432335 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| JO410_RS02225 (JO410_02225) | - | 432367..432849 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| JO410_RS02230 (JO410_02230) | ssb | 432944..433402 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| JO410_RS02235 (JO410_02235) | - | 433507..435999 (+) | 2493 | WP_071981425.1 | ATP-binding protein | - |
| JO410_RS02240 (JO410_02240) | - | 435956..436354 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| JO410_RS02245 (JO410_02245) | - | 436367..438712 (+) | 2346 | WP_002415816.1 | CD3337/EF1877 family mobilome membrane protein | - |
| JO410_RS02250 (JO410_02250) | - | 438699..440957 (+) | 2259 | WP_002415815.1 | type IV secretory system conjugative DNA transfer family protein | - |
| JO410_RS02255 (JO410_02255) | - | 441480..442265 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| JO410_RS02260 (JO410_02260) | - | 442271..442759 (+) | 489 | WP_002415813.1 | hypothetical protein | - |
| JO410_RS02265 (JO410_02265) | - | 443351..443617 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| JO410_RS02270 (JO410_02270) | - | 443650..444150 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| JO410_RS02275 (JO410_02275) | - | 444163..444411 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| JO410_RS02280 (JO410_02280) | - | 444487..444903 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| JO410_RS02285 (JO410_02285) | - | 444927..445511 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| JO410_RS02290 (JO410_02290) | - | 445622..445888 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| JO410_RS02295 (JO410_02295) | - | 445881..446156 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| JO410_RS02300 (JO410_02300) | - | 446347..447027 (-) | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| JO410_RS02305 (JO410_02305) | - | 447195..447803 (+) | 609 | WP_002361211.1 | response regulator transcription factor | - |
| JO410_RS02310 (JO410_02310) | - | 448231..449106 (+) | 876 | WP_002390484.1 | aldo/keto reductase | - |
| JO410_RS02315 (JO410_02315) | - | 449129..449611 (+) | 483 | WP_002397525.1 | VOC family protein | - |
| JO410_RS02320 (JO410_02320) | cls | 449777..451222 (+) | 1446 | WP_002361214.1 | cardiolipin synthase | - |
| JO410_RS02325 (JO410_02325) | tyrS | 451920..453176 (+) | 1257 | WP_002355444.1 | tyrosine--tRNA ligase | - |
| JO410_RS02330 (JO410_02330) | tdc | 453475..455337 (+) | 1863 | WP_002355450.1 | tyrosine decarboxylase | - |
| JO410_RS02335 (JO410_02335) | tyrP | 455540..456958 (+) | 1419 | WP_002355453.1 | tyrosine-tyramine antiporter | - |
| JO410_RS02340 (JO410_02340) | nhaC | 457083..458489 (+) | 1407 | WP_002397523.1 | Na+/H+ antiporter NhaC | - |
| JO410_RS02345 (JO410_02345) | - | 458845..459762 (+) | 918 | WP_002397522.1 | hypothetical protein | - |
| JO410_RS02350 (JO410_02350) | - | 459815..460264 (-) | 450 | WP_002355456.1 | YehR family lipoprotein | - |
| JO410_RS02355 (JO410_02355) | - | 460403..460909 (-) | 507 | WP_002355457.1 | phosphatidylglycerophosphatase A | - |
| JO410_RS02360 (JO410_02360) | - | 461041..461994 (-) | 954 | WP_002358635.1 | L-lactate dehydrogenase | - |
| JO410_RS02365 (JO410_02365) | - | 462162..462524 (+) | 363 | WP_002363122.1 | DUF4809 family protein | - |
| JO410_RS02370 (JO410_02370) | - | 462540..462950 (+) | 411 | WP_002358638.1 | DUF4809 family protein | - |
| JO410_RS02375 (JO410_02375) | - | 462997..463824 (-) | 828 | WP_002371452.1 | LysR family transcriptional regulator | - |
| JO410_RS02380 (JO410_02380) | - | 463966..464934 (+) | 969 | WP_002355462.1 | TDT family transporter | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=532775 JO410_RS02230 WP_002365911.1 432944..433402(+) (ssb) [Enterococcus faecalis strain L11]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=532775 JO410_RS02230 WP_002365911.1 432944..433402(+) (ssb) [Enterococcus faecalis strain L11]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |