Detailed information NTG0523582

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: JH279_RS16620
• Genome accession: NZ_CP066956
• Coordinates: 3788466..3788876 (-)
• Length: 136 a.a.
• NCBI ID: WP_274390761.1
• Uniprot ID: -
• Organism: Xanthomonas campestris pv. incanae strain 8-14
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3778299..3792963	3788466..3788876	within	0

Gene organization within MGE regions

Location: 3778299..3792963

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JH279_RS16575 (JH279_16520)	-	3778299..3778709 (-)	411	WP_323549302.1	DNA-binding protein	-
JH279_RS16580 (JH279_16525)	sucD	3778813..3779688 (-)	876	WP_011038208.1	succinate--CoA ligase subunit alpha	-
JH279_RS16585 (JH279_16530)	sucC	3779713..3780882 (-)	1170	WP_011038209.1	ADP-forming succinate--CoA ligase subunit beta	-
JH279_RS16590 (JH279_16535)	-	3781116..3782726 (+)	1611	WP_116901781.1	HAMP domain-containing sensor histidine kinase	-
JH279_RS16595 (JH279_16540)	pilR	3782935..3784329 (+)	1395	WP_274390757.1	sigma-54 dependent transcriptional regulator	Regulator
JH279_RS16600 (JH279_16545)	-	3784527..3784883 (+)	357	WP_139328384.1	hypothetical protein	-
JH279_RS16605 (JH279_16550)	-	3784883..3785620 (+)	738	WP_274390758.1	zeta toxin family protein	-
JH279_RS16610 (JH279_16555)	pilB	3785803..3787530 (-)	1728	WP_274390759.1	type IV-A pilus assembly ATPase PilB	Machinery gene
JH279_RS16615 (JH279_16560)	-	3787608..3788420 (-)	813	WP_274390760.1	sterol desaturase family protein	-
JH279_RS16620 (JH279_16565)	comP	3788466..3788876 (-)	411	WP_274390761.1	pilin	Machinery gene
JH279_RS16625 (JH279_16570)	comP	3788960..3789400 (-)	441	WP_274390762.1	pilin	Machinery gene
JH279_RS16630 (JH279_16575)	pilC	3789701..3790957 (+)	1257	WP_274391840.1	type II secretion system F family protein	Machinery gene
JH279_RS16635 (JH279_16580)	-	3790964..3791827 (+)	864	WP_057671659.1	A24 family peptidase	-
JH279_RS16640 (JH279_16585)	coaE	3791841..3792464 (+)	624	WP_274390763.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 14377.59 Da
• Isoelectric Point: 8.4883

>NTDB_id=523582 JH279_RS16620 WP_274390761.1 3788466..3788876(-) (comP) [Xanthomonas campestris pv. incanae strain 8-14]
MRRTNGFTLIELMIVVAIIALLASLALPAYQDYVIRARVAEAISLLSGAKSLVTENINNENLLSASACSGVSSSSPATVN
VSNFTCTGNGVLTVQTTPKAGAVTLSLAPSYVQEEPVKWKCTRIAGKQNYVPSECR

Nucleotide

• Length: 411 bp

>NTDB_id=523582 JH279_RS16620 WP_274390761.1 3788466..3788876(-) (comP) [Xanthomonas campestris pv. incanae strain 8-14]
ATGAGGCGCACTAATGGCTTTACTCTGATTGAGCTGATGATAGTGGTGGCAATCATCGCACTACTTGCTTCGCTCGCATT
GCCTGCGTATCAGGATTATGTCATCCGGGCGCGCGTGGCTGAGGCAATAAGCCTGCTTAGTGGCGCAAAGTCTCTTGTAA
CTGAAAATATCAACAACGAAAACTTATTGAGTGCATCCGCTTGCAGTGGTGTTTCTAGCTCTTCACCTGCTACTGTAAAT
GTGAGTAACTTTACTTGTACGGGGAACGGGGTTCTTACGGTGCAAACTACGCCCAAAGCTGGCGCAGTCACACTTTCTCT
TGCTCCATCCTATGTGCAGGAAGAGCCAGTGAAATGGAAGTGCACGCGGATTGCAGGTAAGCAAAATTACGTGCCTTCAG
AGTGCAGATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (36-136)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Acinetobacter baylyi ADP1	46.98	100	0.515
pilA	Ralstonia pseudosolanacearum GMI1000	41.104	100	0.493
pilA2	Legionella pneumophila str. Paris	44.776	98.529	0.441
pilA2	Legionella pneumophila strain ERS1305867	44.776	98.529	0.441
pilE	Neisseria gonorrhoeae MS11	36.42	100	0.434
pilE	Neisseria gonorrhoeae strain FA1090	38.562	100	0.434