Detailed information NTG0522178

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: JGY90_RS06955
• Genome accession: NZ_CP066726
• Coordinates: 1421092..1421409 (+)
• Length: 105 a.a.
• NCBI ID: WP_029377192.1
• Uniprot ID: -
• Organism: Staphylococcus xylosus strain TMW 2.1324
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1416092..1426409

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JGY90_RS06925 (JGY90_06890)	-	1416442..1416636 (+)	195	WP_042363548.1	YqgQ family protein	-
JGY90_RS06930 (JGY90_06895)	-	1417026..1418012 (+)	987	WP_217873901.1	glucokinase	-
JGY90_RS06935 (JGY90_06900)	-	1418012..1418335 (+)	324	WP_042362616.1	MTH1187 family thiamine-binding protein	-
JGY90_RS06940 (JGY90_06905)	-	1418337..1418960 (+)	624	WP_225518583.1	MBL fold metallo-hydrolase	-
JGY90_RS06945 (JGY90_06910)	comGA	1419059..1420033 (+)	975	WP_225518584.1	competence type IV pilus ATPase ComGA	Machinery gene
JGY90_RS06950 (JGY90_06915)	comGB	1420005..1421072 (+)	1068	WP_225518585.1	competence type IV pilus assembly protein ComGB	-
JGY90_RS06955 (JGY90_06920)	comGC	1421092..1421409 (+)	318	WP_029377192.1	competence type IV pilus major pilin ComGC	Machinery gene
JGY90_RS06960 (JGY90_06925)	comGD	1421384..1421833 (+)	450	WP_225518586.1	competence type IV pilus minor pilin ComGD	-
JGY90_RS06965 (JGY90_06930)	-	1421820..1422119 (+)	300	WP_069794320.1	hypothetical protein	-
JGY90_RS06970 (JGY90_06935)	comGF	1422091..1422534 (+)	444	WP_069794321.1	competence type IV pilus minor pilin ComGF	-
JGY90_RS14245 (JGY90_06940)	-	1422575..1422706 (+)	132	WP_263855849.1	hypothetical protein	-
JGY90_RS06975 (JGY90_06945)	-	1422693..1423214 (+)	522	WP_047172318.1	shikimate kinase	-
JGY90_RS06980 (JGY90_06950)	gcvT	1423402..1424493 (+)	1092	WP_225518587.1	glycine cleavage system aminomethyltransferase GcvT	-
JGY90_RS06985 (JGY90_06955)	gcvPA	1424511..1425863 (+)	1353	WP_225518588.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11788.86 Da
• Isoelectric Point: 8.4952

>NTDB_id=522178 JGY90_RS06955 WP_029377192.1 1421092..1421409(+) (comGC) [Staphylococcus xylosus strain TMW 2.1324]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=522178 JGY90_RS06955 WP_029377192.1 1421092..1421409(+) (comGC) [Staphylococcus xylosus strain TMW 2.1324]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	70.297	96.19	0.676
comGC	Staphylococcus aureus MW2	70.297	96.19	0.676
comYC	Streptococcus gordonii str. Challis substr. CH1	46.296	100	0.476
comGC/cglC	Streptococcus pneumoniae D39	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae R6	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	39.623	100	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	40	100	0.4
comGC/cglC	Streptococcus mitis SK321	41.667	91.429	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	89.524	0.371
comYC	Streptococcus mutans UA140	49.351	73.333	0.362
comYC	Streptococcus mutans UA159	49.351	73.333	0.362