NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	JGY87_RS06795	Genome accession	NZ_CP066719
Coordinates	1413862..1414179 (+)	Length	105 a.a.
NCBI ID	WP_029377192.1	Uniprot ID	-
Organism	Staphylococcus xylosus strain TMW 2.1602
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1408862..1419179

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JGY87_RS06765 (JGY87_06715)	-	1409216..1409413 (+)	198	WP_029377186.1	YqgQ family protein	-
JGY87_RS06770 (JGY87_06720)	-	1409795..1410781 (+)	987	WP_029377187.1	glucokinase	-
JGY87_RS06775 (JGY87_06725)	-	1410781..1411104 (+)	324	WP_029377188.1	MTH1187 family thiamine-binding protein	-
JGY87_RS06780 (JGY87_06730)	-	1411106..1411729 (+)	624	WP_029377189.1	MBL fold metallo-hydrolase	-
JGY87_RS06785 (JGY87_06735)	comGA	1411829..1412803 (+)	975	WP_225489154.1	competence type IV pilus ATPase ComGA	Machinery gene
JGY87_RS06790 (JGY87_06740)	comGB	1412775..1413842 (+)	1068	WP_051664335.1	competence type IV pilus assembly protein ComGB	-
JGY87_RS06795 (JGY87_06745)	comGC	1413862..1414179 (+)	318	WP_029377192.1	competence type IV pilus major pilin ComGC	Machinery gene
JGY87_RS06800 (JGY87_06750)	comGD	1414157..1414603 (+)	447	WP_038679684.1	competence type IV pilus minor pilin ComGD	-
JGY87_RS06805 (JGY87_06755)	-	1414590..1414889 (+)	300	WP_029377194.1	hypothetical protein	-
JGY87_RS06810 (JGY87_06760)	comGF	1414873..1415304 (+)	432	WP_225489156.1	competence type IV pilus minor pilin ComGF	-
JGY87_RS06815 (JGY87_06765)	-	1415484..1415984 (+)	501	WP_037557022.1	shikimate kinase	-
JGY87_RS06820 (JGY87_06770)	gcvT	1416172..1417263 (+)	1092	WP_225489157.1	glycine cleavage system aminomethyltransferase GcvT	-
JGY87_RS06825 (JGY87_06775)	gcvPA	1417281..1418633 (+)	1353	WP_029377199.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11788.86 Da Isoelectric Point: 8.4952

                                >NTDB_id=522110 JGY87_RS06795 WP_029377192.1 1413862..1414179(+) (comGC) [Staphylococcus xylosus strain TMW 2.1602]

MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG

YIKENQKQCKSGALISINDGEAVAN

Nucleotide

Download Length: 318 bp

                                >NTDB_id=522110 JGY87_RS06795 WP_029377192.1 1413862..1414179(+) (comGC) [Staphylococcus xylosus strain TMW 2.1602]

ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTATTAATAATAAGTTT

GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA

TGGTAGATAGTCAAATTGAAGCTTATAGTTTGAAGTTCAATAAGAAGCCAACTACTATGGACGAACTCGTCAACGAAGGT

TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGCGCCTTAATATCGATAAATGATGGTGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(9-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	70.297	96.19	0.676
comGC	Staphylococcus aureus MW2	70.297	96.19	0.676
comYC	Streptococcus gordonii str. Challis substr. CH1	46.296	100	0.476
comGC/cglC	Streptococcus pneumoniae D39	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae R6	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	39.623	100	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	40	100	0.4
comGC/cglC	Streptococcus mitis SK321	41.667	91.429	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	89.524	0.371
comYC	Streptococcus mutans UA140	49.351	73.333	0.362
comYC	Streptococcus mutans UA159	49.351	73.333	0.362

Detailed information NTG0522110