NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	JGZ41_RS06820	Genome accession	NZ_CP066715
Coordinates	1416142..1416465 (+)	Length	107 a.a.
NCBI ID	WP_015729165.1	Uniprot ID	-
Organism	Staphylococcus pseudintermedius strain DSP020
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1411142..1421465

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JGZ41_RS06795 (JGZ41_06795)	-	1411516..1412667 (+)	1152	WP_015729170.1	SNF2-related protein	-
JGZ41_RS06800 (JGZ41_06800)	-	1412667..1413956 (+)	1290	WP_049770165.1	DUF3440 domain-containing protein	-
JGZ41_RS06805 (JGZ41_06805)	-	1413950..1414456 (+)	507	WP_198463136.1	ParB/RepB/Spo0J family partition protein	-
JGZ41_RS06810 (JGZ41_06810)	comGA	1414569..1415093 (+)	525	WP_256726570.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
JGZ41_RS06815 (JGZ41_06815)	comGB	1415062..1416129 (+)	1068	WP_037542939.1	competence type IV pilus assembly protein ComGB	-
JGZ41_RS06820 (JGZ41_06820)	comGC	1416142..1416465 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
JGZ41_RS06825 (JGZ41_06825)	comGD	1416422..1416883 (+)	462	WP_234984582.1	competence type IV pilus minor pilin ComGD	-
JGZ41_RS06830 (JGZ41_06830)	-	1416955..1417188 (+)	234	WP_014613824.1	hypothetical protein	-
JGZ41_RS06835 (JGZ41_06835)	-	1417094..1417579 (+)	486	WP_081378286.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
JGZ41_RS06840 (JGZ41_06840)	-	1417743..1418270 (+)	528	WP_014613826.1	shikimate kinase	-
JGZ41_RS06845 (JGZ41_06845)	gcvT	1418428..1419518 (+)	1091	Protein_1314	glycine cleavage system aminomethyltransferase GcvT	-
JGZ41_RS06850 (JGZ41_06850)	gcvPA	1419531..1420880 (+)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 107 a.a. Molecular weight: 12027.26 Da Isoelectric Point: 9.0966

                                >NTDB_id=522004 JGZ41_RS06820 WP_015729165.1 1416142..1416465(+) (comGC) [Staphylococcus pseudintermedius strain DSP020]

MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR

EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

Download Length: 324 bp

                                >NTDB_id=522004 JGZ41_RS06820 WP_015729165.1 1416142..1416465(+) (comGC) [Staphylococcus pseudintermedius strain DSP020]

ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT

TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT

TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT

GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC

ATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374

Detailed information NTG0522004