Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I6H55_RS12860 | Genome accession | NZ_CP066024 |
| Coordinates | 2638496..2638960 (+) | Length | 154 a.a. |
| NCBI ID | WP_010748122.1 | Uniprot ID | - |
| Organism | Enterococcus casseliflavus strain FDAARGOS_998 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2633875..2670234 | 2638496..2638960 | within | 0 |
Gene organization within MGE regions
Location: 2633875..2670234
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H55_RS12825 (I6H55_12825) | - | 2633875..2634321 (-) | 447 | WP_010748117.1 | hypothetical protein | - |
| I6H55_RS17855 (I6H55_12830) | - | 2634605..2634778 (+) | 174 | WP_369521902.1 | ChbG/HpnK family deacetylase | - |
| I6H55_RS17620 | - | 2634891..2635082 (-) | 192 | WP_230209474.1 | hypothetical protein | - |
| I6H55_RS12835 (I6H55_12835) | - | 2635009..2635233 (+) | 225 | WP_230209467.1 | CPBP family intramembrane glutamic endopeptidase | - |
| I6H55_RS12840 (I6H55_12840) | - | 2635364..2635639 (+) | 276 | WP_010748118.1 | DUF2089 family protein | - |
| I6H55_RS12845 (I6H55_12845) | - | 2635632..2635922 (+) | 291 | WP_010748119.1 | hypothetical protein | - |
| I6H55_RS12850 (I6H55_12850) | - | 2636032..2636223 (+) | 192 | WP_010748120.1 | hypothetical protein | - |
| I6H55_RS12855 (I6H55_12855) | - | 2636319..2638499 (+) | 2181 | WP_034695777.1 | DNA topoisomerase 3 | - |
| I6H55_RS12860 (I6H55_12860) | ssb | 2638496..2638960 (+) | 465 | WP_010748122.1 | single-stranded DNA-binding protein | Machinery gene |
| I6H55_RS12865 (I6H55_12865) | - | 2639069..2639548 (+) | 480 | WP_010748123.1 | hypothetical protein | - |
| I6H55_RS12870 (I6H55_12870) | - | 2639781..2639984 (+) | 204 | WP_002290540.1 | hypothetical protein | - |
| I6H55_RS12875 (I6H55_12875) | - | 2640381..2640710 (-) | 330 | WP_010748124.1 | hypothetical protein | - |
| I6H55_RS12880 (I6H55_12880) | - | 2640831..2641157 (+) | 327 | Protein_2517 | DNA cytosine methyltransferase | - |
| I6H55_RS12885 (I6H55_12885) | - | 2641473..2641676 (+) | 204 | WP_010748125.1 | hypothetical protein | - |
| I6H55_RS12890 (I6H55_12890) | - | 2641721..2642050 (+) | 330 | WP_010748126.1 | hypothetical protein | - |
| I6H55_RS12895 (I6H55_12895) | - | 2642143..2642322 (+) | 180 | WP_010748127.1 | hypothetical protein | - |
| I6H55_RS12900 (I6H55_12900) | - | 2642436..2643098 (+) | 663 | WP_010748128.1 | DUF2786 domain-containing protein | - |
| I6H55_RS12905 (I6H55_12905) | - | 2643125..2643370 (+) | 246 | WP_010748129.1 | hypothetical protein | - |
| I6H55_RS12910 (I6H55_12910) | - | 2643327..2643683 (+) | 357 | WP_010748130.1 | hypothetical protein | - |
| I6H55_RS17730 | - | 2643726..2643848 (+) | 123 | WP_010748131.1 | hypothetical protein | - |
| I6H55_RS17625 | - | 2643877..2644113 (+) | 237 | WP_010748132.1 | DUF6075 family protein | - |
| I6H55_RS12920 (I6H55_12920) | - | 2644719..2645087 (+) | 369 | WP_010748134.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| I6H55_RS12925 (I6H55_12925) | - | 2645435..2645680 (+) | 246 | WP_010748135.1 | hypothetical protein | - |
| I6H55_RS12930 (I6H55_12930) | - | 2645770..2646612 (+) | 843 | WP_010748136.1 | McbB family protein | - |
| I6H55_RS12935 (I6H55_12935) | - | 2646605..2647228 (+) | 624 | WP_034695557.1 | hypothetical protein | - |
| I6H55_RS12940 (I6H55_12940) | - | 2647230..2648186 (+) | 957 | WP_010748138.1 | hypothetical protein | - |
| I6H55_RS12945 (I6H55_12945) | - | 2648201..2649235 (+) | 1035 | WP_010748139.1 | YcaO-like family protein | - |
| I6H55_RS12950 (I6H55_12950) | - | 2649884..2650843 (+) | 960 | WP_198479181.1 | IS30-like element IS6770 family transposase | - |
| I6H55_RS12955 (I6H55_12955) | - | 2651009..2651602 (+) | 594 | WP_010748141.1 | ATP-binding cassette domain-containing protein | - |
| I6H55_RS12960 (I6H55_12960) | - | 2651813..2652205 (+) | 393 | WP_034695559.1 | hypothetical protein | - |
| I6H55_RS12965 (I6H55_12965) | - | 2652861..2652998 (+) | 138 | WP_080646975.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| I6H55_RS12970 (I6H55_12970) | dltA | 2653010..2654527 (+) | 1518 | WP_010748143.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| I6H55_RS12975 (I6H55_12975) | dltB | 2654524..2655723 (+) | 1200 | WP_005237703.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| I6H55_RS12980 (I6H55_12980) | dltC | 2655738..2655980 (+) | 243 | WP_010748144.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| I6H55_RS12985 (I6H55_12985) | dltD | 2655977..2657251 (+) | 1275 | WP_010748145.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| I6H55_RS12990 (I6H55_12990) | - | 2657297..2658538 (+) | 1242 | WP_010748146.1 | serine hydrolase domain-containing protein | - |
| I6H55_RS12995 (I6H55_12995) | - | 2658893..2659060 (-) | 168 | WP_010748147.1 | hypothetical protein | - |
| I6H55_RS13000 (I6H55_13000) | - | 2660226..2660540 (+) | 315 | WP_010748148.1 | ArsR/SmtB family transcription factor | - |
| I6H55_RS13005 (I6H55_13005) | arsB | 2660554..2661633 (+) | 1080 | WP_005237696.1 | ACR3 family arsenite efflux transporter | - |
| I6H55_RS13010 (I6H55_13010) | - | 2661651..2663318 (+) | 1668 | WP_010748149.1 | FAD-dependent oxidoreductase | - |
| I6H55_RS13015 (I6H55_13015) | - | 2663439..2663795 (+) | 357 | WP_010748150.1 | hypothetical protein | - |
| I6H55_RS13020 (I6H55_13020) | - | 2664144..2665334 (+) | 1191 | WP_010748152.1 | IS256 family transposase | - |
| I6H55_RS13025 (I6H55_13025) | - | 2665846..2666325 (+) | 480 | WP_010748153.1 | GGDEF domain-containing protein | - |
| I6H55_RS13030 (I6H55_13030) | - | 2666729..2667799 (+) | 1071 | WP_010748154.1 | chromate transporter | - |
| I6H55_RS13035 (I6H55_13035) | - | 2668636..2668839 (+) | 204 | WP_005225249.1 | hypothetical protein | - |
| I6H55_RS13040 (I6H55_13040) | - | 2668915..2669064 (-) | 150 | WP_005237684.1 | hypothetical protein | - |
| I6H55_RS13045 (I6H55_13045) | - | 2669360..2669560 (+) | 201 | WP_005237682.1 | cold-shock protein | - |
| I6H55_RS13050 (I6H55_13050) | - | 2669627..2669842 (+) | 216 | WP_010748155.1 | hypothetical protein | - |
| I6H55_RS13055 (I6H55_13055) | - | 2669929..2670234 (+) | 306 | WP_010748156.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17089.13 Da Isoelectric Point: 4.9821
>NTDB_id=516538 I6H55_RS12860 WP_010748122.1 2638496..2638960(+) (ssb) [Enterococcus casseliflavus strain FDAARGOS_998]
MINNVVLVGRLTRDPELKFTPNGAAVATFTLAVNRNFTNQSGQREADFINCVIWRKPAETLANYAKKGTLLGVTGRIQTR
SYDNPQGQRVYVTEVVAETFQLMESKDVSEQRSNESNETAEKSKPTPPPLPKKETDPFAQSSSAIDLPDDDLPF
MINNVVLVGRLTRDPELKFTPNGAAVATFTLAVNRNFTNQSGQREADFINCVIWRKPAETLANYAKKGTLLGVTGRIQTR
SYDNPQGQRVYVTEVVAETFQLMESKDVSEQRSNESNETAEKSKPTPPPLPKKETDPFAQSSSAIDLPDDDLPF
Nucleotide
Download Length: 465 bp
>NTDB_id=516538 I6H55_RS12860 WP_010748122.1 2638496..2638960(+) (ssb) [Enterococcus casseliflavus strain FDAARGOS_998]
ATGATCAATAACGTCGTATTAGTAGGAAGATTAACGAGAGATCCAGAATTAAAATTTACACCGAACGGTGCTGCAGTGGC
CACGTTCACTTTGGCCGTGAATCGAAATTTTACCAATCAAAGCGGTCAAAGAGAAGCTGACTTCATCAATTGTGTCATTT
GGCGCAAACCAGCCGAAACCCTTGCCAATTACGCAAAGAAAGGGACGCTTCTCGGCGTGACTGGACGTATTCAGACAAGA
TCTTACGATAACCCACAAGGACAGCGAGTGTACGTCACAGAAGTCGTGGCAGAGACGTTTCAATTAATGGAATCAAAAGA
TGTGTCTGAGCAGCGTTCGAATGAATCCAACGAAACAGCTGAAAAAAGCAAACCAACACCGCCGCCGCTACCTAAAAAAG
AAACGGATCCATTTGCACAAAGCAGCTCGGCAATCGATTTACCAGATGATGATTTACCATTTTGA
ATGATCAATAACGTCGTATTAGTAGGAAGATTAACGAGAGATCCAGAATTAAAATTTACACCGAACGGTGCTGCAGTGGC
CACGTTCACTTTGGCCGTGAATCGAAATTTTACCAATCAAAGCGGTCAAAGAGAAGCTGACTTCATCAATTGTGTCATTT
GGCGCAAACCAGCCGAAACCCTTGCCAATTACGCAAAGAAAGGGACGCTTCTCGGCGTGACTGGACGTATTCAGACAAGA
TCTTACGATAACCCACAAGGACAGCGAGTGTACGTCACAGAAGTCGTGGCAGAGACGTTTCAATTAATGGAATCAAAAGA
TGTGTCTGAGCAGCGTTCGAATGAATCCAACGAAACAGCTGAAAAAAGCAAACCAACACCGCCGCCGCTACCTAAAAAAG
AAACGGATCCATTTGCACAAAGCAGCTCGGCAATCGATTTACCAGATGATGATTTACCATTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.623 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.61 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
61.321 |
68.831 |
0.422 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.153 |
76.623 |
0.377 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50 |
74.026 |
0.37 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.305 |
76.623 |
0.37 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.305 |
76.623 |
0.37 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.305 |
76.623 |
0.37 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.305 |
76.623 |
0.37 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
48.305 |
76.623 |
0.37 |