Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I6H68_RS04575 | Genome accession | NZ_CP065967 |
| Coordinates | 902319..902741 (-) | Length | 140 a.a. |
| NCBI ID | WP_195748895.1 | Uniprot ID | - |
| Organism | Pediococcus pentosaceus strain FDAARGOS_1011 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 872244..919042 | 902319..902741 | within | 0 |
Gene organization within MGE regions
Location: 872244..919042
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H68_RS04375 (I6H68_04375) | - | 872244..873620 (-) | 1377 | WP_128886915.1 | amino acid permease | - |
| I6H68_RS04380 (I6H68_04380) | - | 875004..876341 (-) | 1338 | WP_195748863.1 | GH25 family lysozyme | - |
| I6H68_RS04385 (I6H68_04385) | - | 876325..876576 (-) | 252 | WP_195748864.1 | phage holin | - |
| I6H68_RS04390 (I6H68_04390) | - | 876576..876860 (-) | 285 | WP_195748916.1 | hypothetical protein | - |
| I6H68_RS04395 (I6H68_04395) | - | 876912..877058 (-) | 147 | WP_195748865.1 | XkdX family protein | - |
| I6H68_RS04400 (I6H68_04400) | - | 877058..877366 (-) | 309 | WP_195748866.1 | DUF2977 domain-containing protein | - |
| I6H68_RS04405 (I6H68_04405) | - | 877378..878145 (-) | 768 | WP_195748867.1 | hypothetical protein | - |
| I6H68_RS04410 (I6H68_04410) | - | 878135..879961 (-) | 1827 | WP_195748868.1 | phage baseplate upper protein | - |
| I6H68_RS04415 (I6H68_04415) | - | 879965..880411 (-) | 447 | WP_195748869.1 | hypothetical protein | - |
| I6H68_RS04420 (I6H68_04420) | - | 880395..883400 (-) | 3006 | WP_195748870.1 | peptidoglycan amidohydrolase family protein | - |
| I6H68_RS04425 (I6H68_04425) | - | 883400..884164 (-) | 765 | WP_195748871.1 | phage tail protein | - |
| I6H68_RS04430 (I6H68_04430) | - | 884164..887514 (-) | 3351 | WP_195748872.1 | phage tail tape measure protein | - |
| I6H68_RS04435 (I6H68_04435) | - | 887507..887839 (-) | 333 | WP_229572677.1 | hypothetical protein | - |
| I6H68_RS04440 (I6H68_04440) | - | 887941..888279 (-) | 339 | WP_158190622.1 | tail assembly chaperone | - |
| I6H68_RS04445 (I6H68_04445) | - | 888359..888637 (-) | 279 | WP_159276415.1 | hypothetical protein | - |
| I6H68_RS04450 (I6H68_04450) | - | 888715..889311 (-) | 597 | WP_195748873.1 | phage major tail protein, TP901-1 family | - |
| I6H68_RS04455 (I6H68_04455) | - | 889329..889745 (-) | 417 | WP_195748874.1 | hypothetical protein | - |
| I6H68_RS04460 (I6H68_04460) | - | 889746..890117 (-) | 372 | WP_167399586.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I6H68_RS04465 (I6H68_04465) | - | 890110..890412 (-) | 303 | WP_195748875.1 | hypothetical protein | - |
| I6H68_RS04470 (I6H68_04470) | - | 890417..890788 (-) | 372 | WP_195748876.1 | phage head-tail connector protein | - |
| I6H68_RS04475 (I6H68_04475) | - | 890801..891034 (-) | 234 | WP_232621578.1 | Ig-like domain-containing protein | - |
| I6H68_RS04480 (I6H68_04480) | - | 891085..891999 (-) | 915 | WP_195748877.1 | phage capsid protein | - |
| I6H68_RS04485 (I6H68_04485) | - | 892014..892625 (-) | 612 | WP_195748878.1 | DUF4355 domain-containing protein | - |
| I6H68_RS04490 (I6H68_04490) | - | 892735..892950 (-) | 216 | WP_195748879.1 | hypothetical protein | - |
| I6H68_RS04495 (I6H68_04495) | - | 892953..893351 (-) | 399 | WP_195748880.1 | hypothetical protein | - |
| I6H68_RS04500 (I6H68_04500) | - | 893354..894316 (-) | 963 | WP_195748881.1 | minor capsid protein | - |
| I6H68_RS04505 (I6H68_04505) | - | 894300..895697 (-) | 1398 | WP_195748882.1 | phage portal protein | - |
| I6H68_RS04510 (I6H68_04510) | - | 895705..896976 (-) | 1272 | WP_195748883.1 | PBSX family phage terminase large subunit | - |
| I6H68_RS04515 (I6H68_04515) | - | 896960..897565 (-) | 606 | WP_195748884.1 | terminase small subunit | - |
| I6H68_RS04520 (I6H68_04520) | - | 897565..897738 (-) | 174 | WP_195748885.1 | hypothetical protein | - |
| I6H68_RS04530 (I6H68_04530) | - | 898295..898738 (-) | 444 | WP_195748886.1 | hypothetical protein | - |
| I6H68_RS04535 (I6H68_04535) | relB | 898869..899099 (+) | 231 | WP_195748887.1 | type II toxin-antitoxin system RelB family antitoxin | - |
| I6H68_RS04540 (I6H68_04540) | - | 899096..899362 (+) | 267 | WP_195748888.1 | type II toxin-antitoxin system RelE family toxin | - |
| I6H68_RS09080 | - | 899522..899644 (-) | 123 | WP_267873296.1 | hypothetical protein | - |
| I6H68_RS04545 (I6H68_04545) | - | 899644..899862 (-) | 219 | WP_195748889.1 | hypothetical protein | - |
| I6H68_RS04550 (I6H68_04550) | - | 900278..900514 (-) | 237 | WP_195748890.1 | hypothetical protein | - |
| I6H68_RS04555 (I6H68_04555) | - | 900507..900815 (-) | 309 | WP_198454188.1 | hypothetical protein | - |
| I6H68_RS04560 (I6H68_04560) | - | 900994..901179 (-) | 186 | WP_195748891.1 | DUF6877 family protein | - |
| I6H68_RS04565 (I6H68_04565) | - | 901172..901549 (-) | 378 | WP_198454189.1 | hypothetical protein | - |
| I6H68_RS04570 (I6H68_04570) | - | 901704..902168 (-) | 465 | WP_195748894.1 | hypothetical protein | - |
| I6H68_RS04575 (I6H68_04575) | ssb | 902319..902741 (-) | 423 | WP_195748895.1 | single-stranded DNA-binding protein | Machinery gene |
| I6H68_RS04580 (I6H68_04580) | - | 902734..902886 (-) | 153 | WP_195748896.1 | hypothetical protein | - |
| I6H68_RS04585 (I6H68_04585) | - | 902904..903164 (-) | 261 | WP_195748897.1 | hypothetical protein | - |
| I6H68_RS04590 (I6H68_04590) | - | 903133..903834 (-) | 702 | WP_195748898.1 | putative HNHc nuclease | - |
| I6H68_RS04595 (I6H68_04595) | - | 903838..904665 (-) | 828 | WP_159234101.1 | helix-turn-helix domain-containing protein | - |
| I6H68_RS04600 (I6H68_04600) | - | 904675..905502 (-) | 828 | WP_195748899.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| I6H68_RS04605 (I6H68_04605) | - | 905462..906313 (-) | 852 | WP_138428639.1 | recombinase RecT | - |
| I6H68_RS04610 (I6H68_04610) | - | 906306..906587 (-) | 282 | WP_195748900.1 | hypothetical protein | - |
| I6H68_RS09085 | - | 906680..906811 (-) | 132 | WP_267873297.1 | hypothetical protein | - |
| I6H68_RS04615 (I6H68_04615) | - | 906825..907100 (-) | 276 | WP_195748901.1 | helix-turn-helix domain-containing protein | - |
| I6H68_RS04620 (I6H68_04620) | - | 907101..907559 (-) | 459 | WP_229572679.1 | helix-turn-helix domain-containing protein | - |
| I6H68_RS04625 (I6H68_04625) | - | 907633..907803 (-) | 171 | WP_195748902.1 | hypothetical protein | - |
| I6H68_RS04630 (I6H68_04630) | - | 907834..908043 (-) | 210 | WP_195748903.1 | helix-turn-helix domain-containing protein | - |
| I6H68_RS04635 (I6H68_04635) | - | 908208..908576 (+) | 369 | WP_195748904.1 | helix-turn-helix domain-containing protein | - |
| I6H68_RS04640 (I6H68_04640) | - | 908580..908978 (+) | 399 | WP_069825264.1 | hypothetical protein | - |
| I6H68_RS04645 (I6H68_04645) | - | 909034..909471 (+) | 438 | WP_195748905.1 | hypothetical protein | - |
| I6H68_RS04650 (I6H68_04650) | - | 909583..910653 (+) | 1071 | WP_195748906.1 | DUF4236 domain-containing protein | - |
| I6H68_RS04655 (I6H68_04655) | - | 910742..911044 (+) | 303 | WP_195748907.1 | hypothetical protein | - |
| I6H68_RS04660 (I6H68_04660) | - | 911141..912313 (+) | 1173 | WP_195748908.1 | tyrosine-type recombinase/integrase | - |
| I6H68_RS04665 (I6H68_04665) | fabI | 912452..913210 (-) | 759 | WP_060743755.1 | enoyl-ACP reductase FabI | - |
| I6H68_RS04670 (I6H68_04670) | accA | 913227..913994 (-) | 768 | WP_002833592.1 | carboxyltransferase subunit alpha | - |
| I6H68_RS04675 (I6H68_04675) | - | 914008..914838 (-) | 831 | WP_002833591.1 | acetyl-CoA carboxylase carboxyltransferase subunit beta | - |
| I6H68_RS04680 (I6H68_04680) | - | 914828..916195 (-) | 1368 | WP_029257879.1 | acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha | - |
| I6H68_RS04685 (I6H68_04685) | - | 916213..916626 (-) | 414 | WP_011673308.1 | 3-hydroxyacyl-ACP dehydratase FabZ family protein | - |
| I6H68_RS04690 (I6H68_04690) | - | 916626..917063 (-) | 438 | WP_060743756.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| I6H68_RS04695 (I6H68_04695) | fabF | 917069..918295 (-) | 1227 | WP_060743707.1 | beta-ketoacyl-ACP synthase II | - |
| I6H68_RS04700 (I6H68_04700) | fabG | 918314..919042 (-) | 729 | WP_011673305.1 | 3-oxoacyl-ACP reductase FabG | - |
Sequence
Protein
Download Length: 140 a.a. Molecular weight: 15742.50 Da Isoelectric Point: 7.7895
>NTDB_id=515822 I6H68_RS04575 WP_195748895.1 902319..902741(-) (ssb) [Pediococcus pentosaceus strain FDAARGOS_1011]
MISRTILVGRLTNDPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCKFTRKGSLIGIDGRIQTR
SYDNQQGTRVFVTEVVAENFSLLESKNSNQNNQNGQSAPSRNPNDPFNSMPDIKDDDLPF
MISRTILVGRLTNDPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCKFTRKGSLIGIDGRIQTR
SYDNQQGTRVFVTEVVAENFSLLESKNSNQNNQNGQSAPSRNPNDPFNSMPDIKDDDLPF
Nucleotide
Download Length: 423 bp
>NTDB_id=515822 I6H68_RS04575 WP_195748895.1 902319..902741(-) (ssb) [Pediococcus pentosaceus strain FDAARGOS_1011]
ATGATTAGTCGAACTATTTTAGTCGGACGTTTAACTAACGATCCAGAACTAAAATACACAGGCAGCGGTGTGGCAGTTGC
AACTTTTACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCGGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAAATTCACTCGAAAAGGGTCGCTAATTGGTATTGATGGACGAATTCAAACTCGT
TCATATGATAATCAGCAAGGTACACGAGTTTTTGTTACTGAGGTCGTAGCGGAGAACTTCTCGCTGCTTGAATCTAAAAA
TAGCAATCAAAATAACCAAAATGGTCAATCAGCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATGCCGGATATCA
AGGATGACGATTTACCGTTCTAG
ATGATTAGTCGAACTATTTTAGTCGGACGTTTAACTAACGATCCAGAACTAAAATACACAGGCAGCGGTGTGGCAGTTGC
AACTTTTACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCGGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAAATTCACTCGAAAAGGGTCGCTAATTGGTATTGATGGACGAATTCAAACTCGT
TCATATGATAATCAGCAAGGTACACGAGTTTTTGTTACTGAGGTCGTAGCGGAGAACTTCTCGCTGCTTGAATCTAAAAA
TAGCAATCAAAATAACCAAAATGGTCAATCAGCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATGCCGGATATCA
AGGATGACGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.671 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.601 |
100 |
0.65 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
75.714 |
0.407 |
| ssbA | Streptococcus mutans UA159 |
37.324 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.62 |
100 |
0.371 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.62 |
100 |
0.371 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
35.915 |
100 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
35.915 |
100 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
35.915 |
100 |
0.364 |
| ssbB/cilA | Streptococcus mitis SK321 |
35.915 |
100 |
0.364 |