Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | I6G42_RS01945 | Genome accession | NZ_CP065707 |
| Coordinates | 402562..402687 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799680.1 | Uniprot ID | A0A428FUE9 |
| Organism | Streptococcus oralis strain FDAARGOS_885 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 397562..407687
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6G42_RS01920 (I6G42_01920) | - | 399694..400236 (+) | 543 | WP_038804778.1 | TetR/AcrR family transcriptional regulator | - |
| I6G42_RS01935 (I6G42_01935) | comE | 400472..401224 (-) | 753 | WP_000866081.1 | competence system response regulator transcription factor ComE | Regulator |
| I6G42_RS01940 (I6G42_01940) | comD | 401221..402540 (-) | 1320 | WP_038804779.1 | competence system sensor histidine kinase ComD | Regulator |
| I6G42_RS01945 (I6G42_01945) | comC | 402562..402687 (-) | 126 | WP_000799680.1 | competence-stimulating peptide ComC | Regulator |
| I6G42_RS01955 (I6G42_01955) | rlmH | 402971..403450 (-) | 480 | WP_038804781.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6G42_RS01960 (I6G42_01960) | htrA | 403634..404824 (+) | 1191 | WP_038804782.1 | S1C family serine protease | Regulator |
| I6G42_RS01965 (I6G42_01965) | spo0J | 404882..405640 (+) | 759 | WP_038804784.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6G42_RS01970 (I6G42_01970) | dnaA | 405864..407225 (+) | 1362 | WP_038804785.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4998.87 Da Isoelectric Point: 10.1884
>NTDB_id=513271 I6G42_RS01945 WP_000799680.1 402562..402687(-) (comC) [Streptococcus oralis strain FDAARGOS_885]
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
Nucleotide
Download Length: 126 bp
>NTDB_id=513271 I6G42_RS01945 WP_000799680.1 402562..402687(-) (comC) [Streptococcus oralis strain FDAARGOS_885]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis SK321 |
58.537 |
100 |
0.585 |
| comC/comC2 | Streptococcus pneumoniae A66 |
53.659 |
100 |
0.537 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |