Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | I6G43_RS00815 | Genome accession | NZ_CP065706 |
| Coordinates | 176809..176934 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799680.1 | Uniprot ID | A0A428FUE9 |
| Organism | Streptococcus oralis strain FDAARGOS_886 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 171809..181934
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6G43_RS00790 (I6G43_00790) | - | 173937..174479 (+) | 543 | WP_000665074.1 | TetR/AcrR family transcriptional regulator | - |
| I6G43_RS00805 (I6G43_00805) | comE | 174719..175471 (-) | 753 | WP_000866081.1 | competence system response regulator transcription factor ComE | Regulator |
| I6G43_RS00810 (I6G43_00810) | comD | 175468..176787 (-) | 1320 | WP_001048119.1 | competence system sensor histidine kinase ComD | Regulator |
| I6G43_RS00815 (I6G43_00815) | comC | 176809..176934 (-) | 126 | WP_000799680.1 | competence-stimulating peptide ComC | Regulator |
| I6G43_RS00825 (I6G43_00825) | rlmH | 177218..177697 (-) | 480 | WP_000694218.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6G43_RS00830 (I6G43_00830) | htrA | 177882..179072 (+) | 1191 | WP_000681799.1 | S1C family serine protease | Regulator |
| I6G43_RS00835 (I6G43_00835) | spo0J | 179130..179888 (+) | 759 | WP_000410355.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6G43_RS00840 (I6G43_00840) | dnaA | 180112..181473 (+) | 1362 | WP_000660603.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4998.87 Da Isoelectric Point: 10.1884
>NTDB_id=513183 I6G43_RS00815 WP_000799680.1 176809..176934(-) (comC) [Streptococcus oralis strain FDAARGOS_886]
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
Nucleotide
Download Length: 126 bp
>NTDB_id=513183 I6G43_RS00815 WP_000799680.1 176809..176934(-) (comC) [Streptococcus oralis strain FDAARGOS_886]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis SK321 |
58.537 |
100 |
0.585 |
| comC/comC2 | Streptococcus pneumoniae A66 |
53.659 |
100 |
0.537 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |