NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	D39N_RS06845	Genome accession	NZ_CP061208
Coordinates	1382787..1383257 (-)	Length	156 a.a.
NCBI ID	WP_000609607.1	Uniprot ID	-
Organism	Streptococcus pneumoniae strain D39_P0
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1377787..1388257

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D39N_RS06815 (D39N_01374)	-	1378362..1379297 (-)	936	WP_000036043.1	manganese-dependent inorganic pyrophosphatase	-
D39N_RS06820 (D39N_01375)	-	1379368..1379667 (-)	300	WP_000349600.1	GIY-YIG nuclease family protein	-
D39N_RS06825 (D39N_01376)	-	1379657..1380406 (-)	750	WP_000390783.1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	-
D39N_RS06830 (D39N_01377)	-	1380460..1380819 (-)	360	WP_000689596.1	S1 RNA-binding domain-containing protein	-
D39N_RS06835 (D39N_01378)	-	1380821..1382221 (-)	1401	WP_000339028.1	bifunctional Cof-type HAD-IIB family hydrolase/peptidylprolyl isomerase	-
D39N_RS06840 (D39N_01379)	rpsR	1382516..1382755 (-)	240	WP_000068664.1	30S ribosomal protein S18	-
D39N_RS06845 (D39N_01380)	ssbA	1382787..1383257 (-)	471	WP_000609607.1	single-stranded DNA-binding protein SsbA	Machinery gene
D39N_RS06850 (D39N_01381)	rpsF	1383269..1383559 (-)	291	WP_001151785.1	30S ribosomal protein S6	-
D39N_RS06855 (D39N_01382)	asnS	1383712..1385058 (-)	1347	WP_162496016.1	asparagine--tRNA ligase	-
D39N_RS06860 (D39N_01383)	-	1385074..1385439 (-)	366	WP_000565221.1	VOC family protein	-
D39N_RS06865 (D39N_01384)	-	1385432..1386619 (-)	1188	WP_000777789.1	pyridoxal phosphate-dependent aminotransferase	-
D39N_RS06870 (D39N_01385)	-	1386616..1387104 (-)	489	WP_000747251.1	DUF5590 domain-containing protein	-
D39N_RS06875 (D39N_01386)	-	1387425..1387973 (+)	549	WP_212551726.1	NADPH-dependent FMN reductase	-

Sequence

Protein

Download Length: 156 a.a. Molecular weight: 17351.21 Da Isoelectric Point: 5.2065

                                >NTDB_id=481403 D39N_RS06845 WP_000609607.1 1382787..1383257(-) (ssbA) [Streptococcus pneumoniae strain D39_P0]

MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTR

SYDNQQGQRVYVTEVVAENFQMLESRSVREGHTGGAYSAPTANYSAPTNSVPDFSRNENPFGATNPLDISDDDLPF

Nucleotide

Download Length: 471 bp

                                >NTDB_id=481403 D39N_RS06845 WP_000609607.1 1382787..1383257(-) (ssbA) [Streptococcus pneumoniae strain D39_P0]

ATGATTAACAATGTTGTACTTGTAGGGCGTATGACACGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTTGC

GACTTTTACTCTTGCAGTAAACCGTACATTTAAGAGTCAAAATGGTGAACGTGAGGCTGATTTTATCAATGTCGTTATGT

GGCGCCAACAGGCTGAAAATCTTGCTAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGTCGTATCCAGACTCGT

AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAGGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGCCGTAG

TGTGCGTGAGGGTCACACAGGTGGAGCTTACTCTGCACCAACTGCAAACTATTCAGCACCTACAAATTCAGTACCAGACT

TTTCACGTAATGAAAATCCATTTGGAGCAACAAACCCATTGGATATTTCAGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	55.814	100	0.615
ssb	Latilactobacillus sakei subsp. sakei 23K	54.118	100	0.59
ssbB	Bacillus subtilis subsp. subtilis str. 168	55.66	67.949	0.378
ssbB	Streptococcus sobrinus strain NIDR 6715-7	54.128	69.872	0.378
ssbB/cilA	Streptococcus pneumoniae TIGR4	53.211	69.872	0.372
ssbB/cilA	Streptococcus mitis SK321	52.294	69.872	0.365
ssbB/cilA	Streptococcus mitis NCTC 12261	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae Rx1	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae D39	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae R6	52.294	69.872	0.365

Detailed information NTG0481403