Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SAT0131_RS08025 | Genome accession | NC_017347 |
| Coordinates | 1627045..1627356 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus T0131 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1622045..1632356
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAT0131_RS07990 (SAT0131_01629) | gcvPA | 1622547..1623893 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SAT0131_RS07995 (SAT0131_01630) | gcvT | 1623913..1625004 (-) | 1092 | WP_000093351.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SAT0131_RS08000 (SAT0131_01631) | - | 1625163..1625687 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| SAT0131_RS08005 | - | 1625677..1625823 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SAT0131_RS08010 (SAT0131_01633) | comGF | 1625920..1626417 (-) | 498 | WP_001803317.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SAT0131_RS08015 (SAT0131_01634) | comGE | 1626335..1626634 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SAT0131_RS08020 (SAT0131_01635) | comGD | 1626621..1627067 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SAT0131_RS08025 (SAT0131_01636) | comGC | 1627045..1627356 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SAT0131_RS08030 (SAT0131_01637) | comGB | 1627370..1628440 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SAT0131_RS08035 (SAT0131_01638) | comGA | 1628412..1629386 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SAT0131_RS08040 (SAT0131_01639) | - | 1629438..1630061 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SAT0131_RS08045 (SAT0131_01640) | - | 1630058..1630387 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SAT0131_RS08050 (SAT0131_01641) | - | 1630387..1631373 (-) | 987 | WP_000161313.1 | ROK family glucokinase | - |
| SAT0131_RS08055 | - | 1631370..1631573 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=46556 SAT0131_RS08025 WP_000472256.1 1627045..1627356(-) (comGC) [Staphylococcus aureus subsp. aureus T0131]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=46556 SAT0131_RS08025 WP_000472256.1 1627045..1627356(-) (comGC) [Staphylococcus aureus subsp. aureus T0131]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |