Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPAKL86_RS00090 Genome accession   NC_019563
Coordinates   11598..11723 (-) Length   41 a.a.
NCBI ID   WP_015086519.1    Uniprot ID   -
Organism   Helicobacter pylori Aklavik86     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 6598..16723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPAKL86_RS00070 (HPAKL86_00045) - 7286..8698 (-) 1413 WP_015086515.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPAKL86_RS00075 (HPAKL86_00050) comB10 8764..9900 (-) 1137 WP_015086516.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPAKL86_RS00080 (HPAKL86_00055) comB9 9893..10858 (-) 966 WP_015086517.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPAKL86_RS00085 (HPAKL86_00060) comB8 10858..11601 (-) 744 WP_015086518.1 type IV secretion system protein Machinery gene
  HPAKL86_RS00090 (HPAKL86_00065) comB7 11598..11723 (-) 126 WP_015086519.1 hypothetical protein Machinery gene
  HPAKL86_RS00095 (HPAKL86_00070) comB6 11749..12804 (-) 1056 WP_015086520.1 P-type conjugative transfer protein TrbL Machinery gene
  HPAKL86_RS00100 (HPAKL86_00075) - 12812..13807 (-) 996 WP_015086521.1 PDZ domain-containing protein -
  HPAKL86_RS00105 (HPAKL86_00080) - 13807..14100 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPAKL86_RS00110 (HPAKL86_00085) panD 14111..14461 (-) 351 WP_015086522.1 aspartate 1-decarboxylase -
  HPAKL86_RS00115 (HPAKL86_00090) - 14451..16670 (-) 2220 WP_015086523.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4726.86 Da        Isoelectric Point: 10.1242

>NTDB_id=45312 HPAKL86_RS00090 WP_015086519.1 11598..11723(-) (comB7) [Helicobacter pylori Aklavik86]
MKIFLLLMGLMLVGCTSKVHEMKKSPCALHEKLHENRLKFA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=45312 HPAKL86_RS00090 WP_015086519.1 11598..11723(-) (comB7) [Helicobacter pylori Aklavik86]
ATGAAAATTTTTTTATTATTGATGGGGTTGATGCTGGTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CGCGTTGCATGAAAAATTGCATGAAAATAGGTTAAAGTTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

63.415

100

0.634


Multiple sequence alignment