NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	GE023_RS00835	Genome accession	NZ_CP053789
Coordinates	134961..135287 (+)	Length	108 a.a.
NCBI ID	WP_159305269.1	Uniprot ID	A0AAE4TS52
Organism	Streptococcus canis strain HL_98_2
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 129961..140287

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GE023_RS00820 (GE023_000820)	-	132598..132963 (+)	366	WP_125073632.1	DUF1033 family protein	-
GE023_RS00825 (GE023_000825)	comYA	133050..133991 (+)	942	WP_003046182.1	competence type IV pilus ATPase ComGA	Machinery gene
GE023_RS00830 (GE023_000830)	comYB	133924..134958 (+)	1035	WP_223824829.1	competence type IV pilus assembly protein ComGB	Machinery gene
GE023_RS00835 (GE023_000835)	comYC	134961..135287 (+)	327	WP_159305269.1	competence type IV pilus major pilin ComGC	Machinery gene
GE023_RS00840 (GE023_000840)	comGD	135262..135690 (+)	429	WP_236494085.1	competence type IV pilus minor pilin ComGD	-
GE023_RS00845 (GE023_000845)	comGE	135668..135943 (+)	276	WP_003046190.1	competence type IV pilus minor pilin ComGE	-
GE023_RS00850 (GE023_000850)	comGF	135924..136364 (+)	441	WP_003046192.1	competence type IV pilus minor pilin ComGF	-
GE023_RS00855 (GE023_000855)	comGG	136342..136722 (+)	381	WP_003046193.1	competence type IV pilus minor pilin ComGG	-
GE023_RS00860 (GE023_000860)	comYH	136772..137725 (+)	954	WP_003046195.1	class I SAM-dependent methyltransferase	Machinery gene
GE023_RS00865 (GE023_000865)	-	137784..138980 (+)	1197	WP_093998734.1	acetate kinase	-
GE023_RS00870 (GE023_000870)	-	139300..139506 (+)	207	WP_003046200.1	helix-turn-helix transcriptional regulator	-
GE023_RS00875 (GE023_000875)	-	139507..139647 (+)	141	Protein_126	CPBP family glutamic-type intramembrane protease	-
GE023_RS10810	-	139772..139927 (+)	156	WP_236493542.1	hypothetical protein	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 12428.40 Da Isoelectric Point: 9.6762

                                >NTDB_id=447140 GE023_RS00835 WP_159305269.1 134961..135287(+) (comYC) [Streptococcus canis strain HL_98_2]

MTNQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDRVTETGHTAVVKLVENQAELYELSQGSKPSLSQLKE

DGSITDKQEKAYRDYYGKHKDEAQKLQP

Nucleotide

Download Length: 327 bp

                                >NTDB_id=447140 GE023_RS00835 WP_159305269.1 134961..135287(+) (comYC) [Streptococcus canis strain HL_98_2]

ATGACAAACCAATGGAACAACTTACGACACAAGAAGCTAAAAGGATTTACTCTTCTAGAAATGTTATTGGTGATTCTTGT

CATCAGTGTTTTGATGCTATTATTTGTGCCAAATTTAAGCAAGCAAAAAGACAGGGTTACCGAGACAGGTCATACCGCTG

TTGTTAAATTAGTGGAGAATCAAGCGGAGCTATATGAATTATCTCAGGGTTCAAAACCAAGTTTGAGCCAACTGAAGGAA

GATGGTAGCATCACTGACAAACAAGAAAAAGCTTATCGCGACTATTATGGCAAACATAAAGATGAAGCTCAAAAATTGCA

ACCTTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(12-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	55.34	95.37	0.528
comGC	Lactococcus lactis subsp. cremoris KW2	57.292	88.889	0.509
comGC/cglC	Streptococcus mitis SK321	58.696	85.185	0.5
comGC/cglC	Streptococcus mitis NCTC 12261	57.609	85.185	0.491
comGC/cglC	Streptococcus pneumoniae TIGR4	56.522	85.185	0.481
comGC/cglC	Streptococcus pneumoniae Rx1	56.522	85.185	0.481
comGC/cglC	Streptococcus pneumoniae R6	56.522	85.185	0.481
comGC/cglC	Streptococcus pneumoniae D39	56.522	85.185	0.481
comYC	Streptococcus mutans UA159	58.621	80.556	0.472
comYC	Streptococcus mutans UA140	58.621	80.556	0.472
comYC	Streptococcus suis isolate S10	55.556	75	0.417

Detailed information NTG0447140