NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	HB751_RS09050	Genome accession	NZ_CP050272
Coordinates	1846407..1846802 (+)	Length	131 a.a.
NCBI ID	WP_019804915.1	Uniprot ID	-
Organism	Streptococcus mutans strain P6
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1841407..1851802

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HB751_RS09010 (HB751_09010)	-	1841582..1842244 (+)	663	WP_002263446.1	type II CAAX endopeptidase family protein	-
HB751_RS09015 (HB751_09015)	proC	1842329..1843099 (-)	771	WP_002263447.1	pyrroline-5-carboxylate reductase	-
HB751_RS09020 (HB751_09020)	pepA	1843155..1844143 (-)	989	Protein_1744	glutamyl aminopeptidase	-
HB751_RS09025 (HB751_09025)	-	1844203..1844511 (+)	309	WP_019317545.1	DUF4651 domain-containing protein	-
HB751_RS09030 (HB751_09030)	-	1844489..1844818 (+)	330	WP_002264003.1	thioredoxin family protein	-
HB751_RS09035 (HB751_09035)	ytpR	1844815..1845441 (+)	627	WP_019804917.1	YtpR family tRNA-binding protein	-
HB751_RS09040 (HB751_09040)	-	1845530..1845961 (+)	432	WP_018110218.1	MarR family winged helix-turn-helix transcriptional regulator	-
HB751_RS09045 (HB751_09045)	-	1845961..1846320 (+)	360	WP_019804916.1	rhodanese-like domain-containing protein	-
HB751_RS09050 (HB751_09050)	ssbA	1846407..1846802 (+)	396	WP_019804915.1	single-stranded DNA-binding protein	Machinery gene
HB751_RS09055 (HB751_09055)	-	1847221..1848183 (+)	963	WP_002280593.1	sugar ABC transporter substrate-binding protein	-
HB751_RS09060 (HB751_09060)	-	1848183..1849505 (+)	1323	WP_002263456.1	sensor histidine kinase	-
HB751_RS09065 (HB751_09065)	-	1849505..1850185 (+)	681	WP_002263457.1	response regulator transcription factor	-
HB751_RS09070 (HB751_09070)	-	1850178..1851485 (+)	1308	WP_002267844.1	extracellular solute-binding protein	-
HB751_RS09075 (HB751_09075)	-	1851551..1851754 (+)	204	Protein_1755	hypothetical protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14855.97 Da Isoelectric Point: 7.2054

                                >NTDB_id=431216 HB751_RS09050 WP_019804915.1 1846407..1846802(+) (ssbA) [Streptococcus mutans strain P6]

MYNKVILIGRLVATPEMVKTPKDKSVTRVTLAVNRRFKSQDGEKQADFVNVVLWGRLAETIASYGSKGSLISLDGELRTR

KYEKDGVTHFVTEVLGHSFQLLESRAQRAMRENNSEKDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=431216 HB751_RS09050 WP_019804915.1 1846407..1846802(+) (ssbA) [Streptococcus mutans strain P6]

ATGTATAATAAAGTTATTTTGATTGGTCGTTTAGTTGCGACACCTGAAATGGTAAAAACACCAAAGGATAAGTCTGTTAC

GCGCGTGACACTGGCTGTCAATCGGCGATTTAAAAGTCAAGATGGGGAAAAGCAGGCTGATTTTGTCAATGTTGTTCTTT

GGGGCAGATTGGCAGAAACAATAGCTTCCTATGGTAGTAAGGGAAGTCTCATCTCTCTTGATGGAGAATTGCGTACCCGT

AAATATGAAAAAGATGGCGTCACTCATTTTGTGACTGAAGTTTTGGGACACTCCTTTCAATTACTGGAAAGTCGTGCTCA

ACGTGCTATGCGTGAAAATAATTCTGAAAAAGATTTGGCCGATTTGGTTCTGGAAGAGGAGGAACTCCCTTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	99.237	100	0.992
ssbB	Streptococcus sobrinus strain NIDR 6715-7	78.626	100	0.786
ssbB/cilA	Streptococcus pneumoniae TIGR4	75.573	100	0.756
ssbB/cilA	Streptococcus pneumoniae Rx1	74.809	100	0.748
ssbB/cilA	Streptococcus pneumoniae D39	74.809	100	0.748
ssbB/cilA	Streptococcus pneumoniae R6	74.809	100	0.748
ssbB/cilA	Streptococcus mitis SK321	74.809	100	0.748
ssbB/cilA	Streptococcus mitis NCTC 12261	73.282	100	0.733
ssbB	Lactococcus lactis subsp. cremoris KW2	58.036	85.496	0.496
ssbA	Bacillus subtilis subsp. subtilis str. 168	50	80.916	0.405

Detailed information NTG0431216