Detailed information NTG0414755

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GU333_RS10460
• Genome accession: NZ_CP047630
• Coordinates: 2103571..2103891 (-)
• Length: 106 a.a.
• NCBI ID: WP_061774318.1
• Uniprot ID: A0A290PY35
• Organism: Lactococcus raffinolactis strain Lr_18_12S
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2098571..2108891

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GU333_RS10420 (GU333_10385)	-	2099096..2099866 (-)	771	WP_245328130.1	metal ABC transporter ATP-binding protein	-
GU333_RS10425 (GU333_10390)	-	2099866..2100315 (-)	450	WP_061774324.1	zinc-dependent MarR family transcriptional regulator	-
GU333_RS10430 (GU333_10395)	-	2100392..2101240 (-)	849	WP_061774323.1	aminotransferase class IV	-
GU333_RS10435 (GU333_10400)	ispE	2101324..2102175 (-)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
GU333_RS10440 (GU333_10405)	comGG	2102180..2102464 (-)	285	WP_096039677.1	competence type IV pilus minor pilin ComGG	-
GU333_RS10445 (GU333_10410)	comGF	2102476..2102919 (-)	444	WP_244165991.1	competence type IV pilus minor pilin ComGF	-
GU333_RS10450 (GU333_10415)	comGE	2102894..2103199 (-)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
GU333_RS10455 (GU333_10420)	comGD	2103171..2103620 (-)	450	WP_167838308.1	competence type IV pilus minor pilin ComGD	-
GU333_RS10460 (GU333_10425)	comYC	2103571..2103891 (-)	321	WP_061774318.1	competence type IV pilus major pilin ComGC	Machinery gene
GU333_RS10465 (GU333_10430)	comYB	2103900..2104985 (-)	1086	WP_342591238.1	competence type IV pilus assembly protein ComGB	Machinery gene
GU333_RS10470 (GU333_10435)	comGA/cglA/cilD	2104867..2105808 (-)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
GU333_RS10475 (GU333_10440)	-	2105871..2107715 (-)	1845	WP_167842442.1	acyltransferase family protein	-
GU333_RS10480 (GU333_10445)	-	2107712..2108074 (-)	363	WP_061774315.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11969.96 Da
• Isoelectric Point: 9.8991

>NTDB_id=414755 GU333_RS10460 WP_061774318.1 2103571..2103891(-) (comYC) [Lactococcus raffinolactis strain Lr_18_12S]
MKKEDMKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNG
NITQKQADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 321 bp

>NTDB_id=414755 GU333_RS10460 WP_061774318.1 2103571..2103891(-) (comYC) [Lactococcus raffinolactis strain Lr_18_12S]
CTGAAGAAAGAAGATATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAG
TGTCTTAATTTTATTGTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAA
AGGTAGTTAACTCGCAAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGC
AATATCACACAAAAACAGGCGGATGCTTATAATGAGTACTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-32)

3D structure

• AlphaFold DB: A0A290PY35

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	95.283	0.632
comYC	Streptococcus mutans UA159	61.538	98.113	0.604
comYC	Streptococcus mutans UA140	61.538	98.113	0.604
comGC/cglC	Streptococcus mitis SK321	63.636	93.396	0.594
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	91.509	0.575
comGC/cglC	Streptococcus pneumoniae R6	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae D39	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	93.396	0.566
comGC	Lactococcus lactis subsp. cremoris KW2	59.783	86.792	0.519
comYC	Streptococcus suis isolate S10	57.5	75.472	0.434