Detailed information NTG0414710

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GU334_RS10610
• Genome accession: NZ_CP047628
• Coordinates: 2162697..2163017 (-)
• Length: 106 a.a.
• NCBI ID: WP_061774318.1
• Uniprot ID: A0A290PY35
• Organism: Lactococcus raffinolactis strain Lr_19_14
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2157697..2168017

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GU334_RS10570 (GU334_10530)	-	2158223..2158993 (-)	771	WP_244165990.1	metal ABC transporter ATP-binding protein	-
GU334_RS10575 (GU334_10535)	-	2158993..2159442 (-)	450	WP_096039675.1	zinc-dependent MarR family transcriptional regulator	-
GU334_RS10580 (GU334_10540)	-	2159518..2160366 (-)	849	WP_167838309.1	aminotransferase class IV	-
GU334_RS10585 (GU334_10545)	ispE	2160450..2161301 (-)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
GU334_RS10590 (GU334_10550)	comGG	2161306..2161590 (-)	285	WP_096039677.1	competence type IV pilus minor pilin ComGG	-
GU334_RS10595 (GU334_10555)	-	2161602..2161874 (-)	273	WP_303620936.1	competence type IV pilus minor pilin ComGF	-
GU334_RS10600 (GU334_10560)	comGE	2162020..2162325 (-)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
GU334_RS11995	comGD	2162297..2162782 (-)	486	WP_312186085.1	competence type IV pilus minor pilin ComGD	-
GU334_RS10610 (GU334_10570)	comYC	2162697..2163017 (-)	321	WP_061774318.1	competence type IV pilus major pilin ComGC	Machinery gene
GU334_RS10615 (GU334_10575)	comYB	2163026..2164111 (-)	1086	WP_245325542.1	competence type IV pilus assembly protein ComGB	Machinery gene
GU334_RS10620 (GU334_10580)	comGA/cglA/cilD	2163993..2164934 (-)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
GU334_RS10625 (GU334_10585)	-	2164997..2166841 (-)	1845	WP_096039681.1	acyltransferase family protein	-
GU334_RS10630 (GU334_10590)	-	2166838..2167200 (-)	363	WP_061774315.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11969.96 Da
• Isoelectric Point: 9.8991

>NTDB_id=414710 GU334_RS10610 WP_061774318.1 2162697..2163017(-) (comYC) [Lactococcus raffinolactis strain Lr_19_14]
MKKEDMKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNG
NITQKQADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 321 bp

>NTDB_id=414710 GU334_RS10610 WP_061774318.1 2162697..2163017(-) (comYC) [Lactococcus raffinolactis strain Lr_19_14]
CTGAAGAAAGAAGATATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAG
TGTCTTAATTTTATTGTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAA
AGGTAGTTAACTCGCAAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGC
AATATCACACAAAAACAGGCGGATGCTTATAATGAGTACTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-32)

3D structure

• AlphaFold DB: A0A290PY35

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	95.283	0.632
comYC	Streptococcus mutans UA159	61.538	98.113	0.604
comYC	Streptococcus mutans UA140	61.538	98.113	0.604
comGC/cglC	Streptococcus mitis SK321	63.636	93.396	0.594
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	91.509	0.575
comGC/cglC	Streptococcus pneumoniae R6	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae D39	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	93.396	0.566
comGC	Lactococcus lactis subsp. cremoris KW2	59.783	86.792	0.519
comYC	Streptococcus suis isolate S10	57.5	75.472	0.434