Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | GU337_RS02060 | Genome accession | NZ_CP047614 |
| Coordinates | 408320..408649 (-) | Length | 109 a.a. |
| NCBI ID | WP_163604800.1 | Uniprot ID | - |
| Organism | Lactococcus raffinolactis strain Lr_19_7 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 404367..447187 | 408320..408649 | within | 0 |
Gene organization within MGE regions
Location: 404367..447187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GU337_RS02030 (GU337_02030) | obgE | 404367..405686 (+) | 1320 | WP_096039988.1 | GTPase ObgE | - |
| GU337_RS02035 | - | 405773..405949 (+) | 177 | WP_003137484.1 | hypothetical protein | - |
| GU337_RS02040 (GU337_02035) | - | 405946..406932 (+) | 987 | WP_061773784.1 | PhoH family protein | - |
| GU337_RS02045 (GU337_02040) | - | 406925..407383 (+) | 459 | WP_138492264.1 | hypothetical protein | - |
| GU337_RS02050 (GU337_02045) | ybeY | 407441..407932 (+) | 492 | WP_061773786.1 | rRNA maturation RNase YbeY | - |
| GU337_RS02055 (GU337_02050) | - | 407916..408317 (+) | 402 | WP_138492265.1 | diacylglycerol kinase family protein | - |
| GU337_RS02060 (GU337_02055) | comFC | 408320..408649 (-) | 330 | WP_163604800.1 | phosphoribosyltransferase family protein | Machinery gene |
| GU337_RS02065 (GU337_02060) | comFA/cflA | 408964..410238 (-) | 1275 | WP_167839723.1 | DEAD/DEAH box helicase | Machinery gene |
| GU337_RS02070 (GU337_02065) | - | 410282..410905 (+) | 624 | WP_096039992.1 | YigZ family protein | - |
| GU337_RS02080 (GU337_02075) | - | 411474..412556 (-) | 1083 | WP_167839724.1 | site-specific integrase | - |
| GU337_RS02085 (GU337_02080) | - | 412679..413230 (-) | 552 | WP_167839725.1 | Ltp family lipoprotein | - |
| GU337_RS02090 (GU337_02085) | - | 413329..414030 (-) | 702 | WP_167839726.1 | XRE family transcriptional regulator | - |
| GU337_RS02095 (GU337_02090) | - | 414224..414451 (+) | 228 | WP_167839727.1 | hypothetical protein | - |
| GU337_RS02100 (GU337_02095) | - | 414474..415250 (+) | 777 | WP_167839728.1 | phage antirepressor | - |
| GU337_RS02105 (GU337_02100) | - | 415316..415603 (+) | 288 | WP_167839729.1 | helix-turn-helix domain-containing protein | - |
| GU337_RS02110 (GU337_02105) | - | 415859..416341 (+) | 483 | WP_167839730.1 | hypothetical protein | - |
| GU337_RS02115 (GU337_02110) | - | 416334..416672 (+) | 339 | WP_167839731.1 | hypothetical protein | - |
| GU337_RS02120 (GU337_02115) | - | 416665..416925 (+) | 261 | WP_167839732.1 | hypothetical protein | - |
| GU337_RS02125 (GU337_02120) | - | 416927..417328 (+) | 402 | WP_167839733.1 | hypothetical protein | - |
| GU337_RS02130 (GU337_02125) | - | 417340..417915 (+) | 576 | WP_167839734.1 | ERF family protein | - |
| GU337_RS02135 (GU337_02130) | ssbA | 417920..418372 (+) | 453 | WP_167839735.1 | single-stranded DNA-binding protein | Machinery gene |
| GU337_RS02140 (GU337_02135) | - | 418384..418539 (+) | 156 | WP_167839736.1 | hypothetical protein | - |
| GU337_RS02145 (GU337_02140) | - | 418541..419287 (+) | 747 | WP_167839737.1 | conserved phage C-terminal domain-containing protein | - |
| GU337_RS02150 (GU337_02145) | - | 419299..419691 (+) | 393 | WP_167839738.1 | hypothetical protein | - |
| GU337_RS02155 (GU337_02150) | - | 419704..420582 (+) | 879 | WP_167839739.1 | ATP-binding protein | - |
| GU337_RS02160 (GU337_02155) | - | 420591..421022 (+) | 432 | WP_167839740.1 | DUF3850 domain-containing protein | - |
| GU337_RS02165 (GU337_02160) | - | 421019..421423 (+) | 405 | WP_167839741.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GU337_RS02170 (GU337_02165) | - | 421413..421688 (+) | 276 | WP_167839742.1 | hypothetical protein | - |
| GU337_RS02175 (GU337_02170) | - | 421693..422088 (+) | 396 | WP_167839743.1 | hypothetical protein | - |
| GU337_RS02180 (GU337_02175) | - | 422072..422470 (+) | 399 | WP_167839744.1 | YopX family protein | - |
| GU337_RS02185 (GU337_02180) | - | 422474..422800 (+) | 327 | WP_167839745.1 | hypothetical protein | - |
| GU337_RS02190 (GU337_02185) | - | 422793..423011 (+) | 219 | WP_167839746.1 | hypothetical protein | - |
| GU337_RS02195 (GU337_02190) | - | 423008..423133 (+) | 126 | WP_167839747.1 | DUF1660 family phage protein | - |
| GU337_RS02200 (GU337_02195) | - | 423146..423691 (+) | 546 | WP_167839748.1 | DUF1642 domain-containing protein | - |
| GU337_RS02205 (GU337_02200) | - | 423727..423873 (+) | 147 | WP_167839749.1 | hypothetical protein | - |
| GU337_RS02210 (GU337_02205) | - | 424122..424607 (+) | 486 | WP_167839750.1 | class I SAM-dependent methyltransferase | - |
| GU337_RS02215 (GU337_02210) | - | 424856..425065 (+) | 210 | WP_167839751.1 | hypothetical protein | - |
| GU337_RS02220 (GU337_02215) | - | 425072..425440 (+) | 369 | WP_167839550.1 | hypothetical protein | - |
| GU337_RS02225 (GU337_02220) | - | 425476..425877 (+) | 402 | WP_167839752.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| GU337_RS02240 (GU337_02235) | - | 427119..427367 (+) | 249 | WP_167839753.1 | hypothetical protein | - |
| GU337_RS02245 (GU337_02240) | - | 427376..427531 (+) | 156 | WP_167839754.1 | hypothetical protein | - |
| GU337_RS02250 (GU337_02245) | - | 427589..427906 (+) | 318 | WP_167839755.1 | HNH endonuclease | - |
| GU337_RS02255 (GU337_02250) | - | 428003..428347 (+) | 345 | WP_167839756.1 | P27 family phage terminase small subunit | - |
| GU337_RS02260 (GU337_02255) | - | 428360..430165 (+) | 1806 | WP_167839757.1 | terminase large subunit | - |
| GU337_RS02265 (GU337_02260) | - | 430175..431371 (+) | 1197 | WP_167839758.1 | phage portal protein | - |
| GU337_RS02270 (GU337_02265) | - | 431371..431973 (+) | 603 | WP_167839759.1 | HK97 family phage prohead protease | - |
| GU337_RS02275 (GU337_02270) | - | 431936..433168 (+) | 1233 | WP_167839760.1 | phage major capsid protein | - |
| GU337_RS02280 | - | 433180..433353 (+) | 174 | WP_167839761.1 | hypothetical protein | - |
| GU337_RS02285 (GU337_02275) | - | 433346..433636 (+) | 291 | WP_167839762.1 | hypothetical protein | - |
| GU337_RS02290 (GU337_02280) | - | 433629..433940 (+) | 312 | WP_167839763.1 | phage head closure protein | - |
| GU337_RS02295 (GU337_02285) | - | 433940..434275 (+) | 336 | WP_167839764.1 | HK97 gp10 family phage protein | - |
| GU337_RS02300 (GU337_02290) | - | 434272..434592 (+) | 321 | WP_167839765.1 | hypothetical protein | - |
| GU337_RS02305 (GU337_02295) | - | 434604..435191 (+) | 588 | WP_167839766.1 | major tail protein | - |
| GU337_RS02310 (GU337_02300) | - | 435259..435618 (+) | 360 | WP_167839767.1 | hypothetical protein | - |
| GU337_RS02315 (GU337_02305) | - | 435933..438695 (+) | 2763 | WP_167839768.1 | phage tail tape measure protein | - |
| GU337_RS02320 (GU337_02310) | - | 438699..439391 (+) | 693 | WP_167839769.1 | phage tail domain-containing protein | - |
| GU337_RS02325 (GU337_02315) | - | 439388..443299 (+) | 3912 | WP_167839770.1 | phage tail spike protein | - |
| GU337_RS02330 (GU337_02320) | - | 443446..443673 (+) | 228 | WP_167839771.1 | hypothetical protein | - |
| GU337_RS02335 (GU337_02325) | - | 443689..444087 (+) | 399 | WP_167839772.1 | phage holin family protein | - |
| GU337_RS02340 (GU337_02330) | - | 444176..444367 (+) | 192 | WP_167839773.1 | hypothetical protein | - |
| GU337_RS02345 (GU337_02335) | - | 444357..445205 (+) | 849 | WP_167839774.1 | peptidoglycan amidohydrolase family protein | - |
| GU337_RS02350 (GU337_02340) | - | 445366..445584 (+) | 219 | WP_167839775.1 | hypothetical protein | - |
| GU337_RS02355 (GU337_02345) | - | 445642..445830 (+) | 189 | WP_167839776.1 | hypothetical protein | - |
| GU337_RS02360 (GU337_02350) | - | 446324..447187 (+) | 864 | WP_167839777.1 | S1 RNA-binding domain-containing protein | - |
Sequence
Protein
Download Length: 109 a.a. Molecular weight: 12126.92 Da Isoelectric Point: 10.4051
>NTDB_id=414588 GU337_RS02060 WP_163604800.1 408320..408649(-) (comFC) [Lactococcus raffinolactis strain Lr_19_7]
MKGQTLVPVPVSPERLQSRGFNQVTGFLSSAKLPYLELLTKEETRHQSHKNRAERLASENPFHLKKNVTIPEHVVLVDDI
FTTGTTLKNGASILKNAGCAHVSTFSLFR
MKGQTLVPVPVSPERLQSRGFNQVTGFLSSAKLPYLELLTKEETRHQSHKNRAERLASENPFHLKKNVTIPEHVVLVDDI
FTTGTTLKNGASILKNAGCAHVSTFSLFR
Nucleotide
Download Length: 330 bp
>NTDB_id=414588 GU337_RS02060 WP_163604800.1 408320..408649(-) (comFC) [Lactococcus raffinolactis strain Lr_19_7]
TTGAAAGGCCAAACTCTCGTACCTGTGCCAGTTTCACCTGAACGACTACAAAGTAGAGGCTTTAATCAAGTCACGGGATT
TTTAAGTAGCGCTAAACTTCCTTATCTTGAACTCCTGACCAAAGAAGAAACGCGGCACCAATCTCACAAAAATCGTGCAG
AGCGCTTAGCTTCTGAAAATCCTTTTCATCTCAAGAAAAATGTTACCATCCCTGAGCACGTGGTTCTCGTAGATGATATT
TTCACGACAGGGACGACCCTTAAAAATGGTGCAAGCATATTAAAAAACGCAGGCTGCGCCCACGTTTCTACTTTTTCATT
ATTTCGCTAA
TTGAAAGGCCAAACTCTCGTACCTGTGCCAGTTTCACCTGAACGACTACAAAGTAGAGGCTTTAATCAAGTCACGGGATT
TTTAAGTAGCGCTAAACTTCCTTATCTTGAACTCCTGACCAAAGAAGAAACGCGGCACCAATCTCACAAAAATCGTGCAG
AGCGCTTAGCTTCTGAAAATCCTTTTCATCTCAAGAAAAATGTTACCATCCCTGAGCACGTGGTTCTCGTAGATGATATT
TTCACGACAGGGACGACCCTTAAAAATGGTGCAAGCATATTAAAAAACGCAGGCTGCGCCCACGTTTCTACTTTTTCATT
ATTTCGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Lactococcus lactis subsp. cremoris KW2 |
53.846 |
95.413 |
0.514 |
| comFC/cflB | Streptococcus mitis NCTC 12261 |
50.926 |
99.083 |
0.505 |
| comFC/cflB | Streptococcus mitis SK321 |
50 |
99.083 |
0.495 |
| comFC/cflB | Streptococcus pneumoniae TIGR4 |
49.074 |
99.083 |
0.486 |
| comFC/cflB | Streptococcus pneumoniae R6 |
49.074 |
99.083 |
0.486 |
| comFC/cflB | Streptococcus pneumoniae Rx1 |
49.074 |
99.083 |
0.486 |
| comFC/cflB | Streptococcus pneumoniae D39 |
49.074 |
99.083 |
0.486 |
| comFC | Bacillus subtilis subsp. subtilis str. 168 |
40 |
96.33 |
0.385 |
| comFC | Latilactobacillus sakei subsp. sakei 23K |
37.615 |
100 |
0.376 |
| comFC | Legionella pneumophila strain ERS1305867 |
34.188 |
100 |
0.367 |
| comFC | Legionella pneumophila str. Paris |
34.188 |
100 |
0.367 |