Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LF543_RS02565 | Genome accession | NZ_CP045562 |
| Coordinates | 502144..502566 (+) | Length | 140 a.a. |
| NCBI ID | WP_010021672.1 | Uniprot ID | A0AAE6NZT2 |
| Organism | Fructilactobacillus fructivorans strain LF543 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 489190..527840 | 502144..502566 | within | 0 |
Gene organization within MGE regions
Location: 489190..527840
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LF543_RS02455 (LF543_02425) | - | 489190..489822 (-) | 633 | WP_010021710.1 | deoxynucleoside kinase | - |
| LF543_RS02460 (LF543_02430) | - | 490010..490666 (+) | 657 | WP_225429585.1 | type II CAAX endopeptidase family protein | - |
| LF543_RS02465 (LF543_02435) | - | 490678..491307 (+) | 630 | WP_010021707.1 | miniconductance mechanosensitive channel MscM | - |
| LF543_RS02470 (LF543_02440) | - | 491307..491807 (+) | 501 | WP_010021706.1 | phosphatidylglycerophosphatase A | - |
| LF543_RS02475 (LF543_02445) | - | 491842..492069 (-) | 228 | WP_010021705.1 | hypothetical protein | - |
| LF543_RS02480 | - | 493189..493350 (+) | 162 | WP_010021703.1 | hypothetical protein | - |
| LF543_RS02485 (LF543_02450) | - | 493639..494460 (+) | 822 | WP_010021701.1 | glycosyltransferase family 8 protein | - |
| LF543_RS02490 (LF543_02455) | - | 494851..495972 (-) | 1122 | WP_010021700.1 | site-specific integrase | - |
| LF543_RS02495 (LF543_02460) | - | 496113..496487 (-) | 375 | WP_010021699.1 | hypothetical protein | - |
| LF543_RS02500 (LF543_02465) | - | 496547..496900 (-) | 354 | WP_010021698.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LF543_RS02505 (LF543_02470) | - | 497166..497486 (-) | 321 | WP_010021696.1 | hypothetical protein | - |
| LF543_RS02510 (LF543_02475) | - | 497523..497861 (-) | 339 | WP_056936270.1 | helix-turn-helix domain-containing protein | - |
| LF543_RS02515 (LF543_02480) | - | 498110..498319 (+) | 210 | WP_010021688.1 | hypothetical protein | - |
| LF543_RS02520 | - | 498325..498465 (+) | 141 | WP_010021687.1 | hypothetical protein | - |
| LF543_RS02525 (LF543_02485) | - | 498871..499125 (+) | 255 | WP_010021683.1 | hypothetical protein | - |
| LF543_RS02530 (LF543_02490) | - | 499106..499345 (-) | 240 | WP_029327108.1 | hypothetical protein | - |
| LF543_RS02535 (LF543_02495) | - | 499409..499621 (+) | 213 | WP_010021681.1 | MW1434 family type I TA system toxin | - |
| LF543_RS02540 (LF543_02500) | - | 499675..499881 (+) | 207 | WP_010021680.1 | hypothetical protein | - |
| LF543_RS02545 (LF543_02505) | - | 499856..500377 (-) | 522 | WP_010021679.1 | hypothetical protein | - |
| LF543_RS02550 (LF543_02510) | - | 500433..500690 (+) | 258 | WP_010021677.1 | helix-turn-helix domain-containing protein | - |
| LF543_RS02555 (LF543_02515) | - | 500925..501404 (+) | 480 | WP_010021674.1 | siphovirus Gp157 family protein | - |
| LF543_RS02560 (LF543_02520) | - | 501413..502147 (+) | 735 | WP_010021673.1 | DUF1071 domain-containing protein | - |
| LF543_RS02565 (LF543_02525) | ssb | 502144..502566 (+) | 423 | WP_010021672.1 | single-stranded DNA-binding protein | Machinery gene |
| LF543_RS02570 (LF543_02530) | - | 502587..503402 (+) | 816 | WP_010021671.1 | hypothetical protein | - |
| LF543_RS02575 (LF543_02535) | - | 503437..504147 (+) | 711 | WP_201781237.1 | phage regulatory protein/antirepressor Ant | - |
| LF543_RS02580 (LF543_02540) | - | 504140..504538 (+) | 399 | WP_010021668.1 | DUF1064 domain-containing protein | - |
| LF543_RS02585 (LF543_02545) | - | 504551..504973 (+) | 423 | WP_010021667.1 | hypothetical protein | - |
| LF543_RS02590 (LF543_02550) | - | 505299..505721 (+) | 423 | WP_010021666.1 | autolysin regulatory protein arpU | - |
| LF543_RS02595 (LF543_02555) | - | 506212..506727 (+) | 516 | WP_010021665.1 | HNH endonuclease | - |
| LF543_RS02600 (LF543_02560) | - | 507004..507507 (+) | 504 | WP_081454149.1 | phage terminase small subunit P27 family | - |
| LF543_RS02605 (LF543_02565) | - | 507504..509390 (+) | 1887 | WP_010021662.1 | terminase large subunit | - |
| LF543_RS02610 (LF543_02570) | - | 509406..509603 (+) | 198 | WP_010021660.1 | DUF1056 family protein | - |
| LF543_RS02615 (LF543_02575) | - | 509603..510712 (+) | 1110 | WP_010021659.1 | phage portal protein | - |
| LF543_RS02620 (LF543_02580) | - | 510732..511451 (+) | 720 | WP_010021658.1 | head maturation protease, ClpP-related | - |
| LF543_RS02625 (LF543_02585) | - | 511469..512695 (+) | 1227 | WP_010021657.1 | phage major capsid protein | - |
| LF543_RS02630 (LF543_02590) | - | 512701..513030 (+) | 330 | WP_010021655.1 | head-tail connector protein | - |
| LF543_RS02635 (LF543_02595) | - | 513023..513367 (+) | 345 | WP_010021653.1 | phage head closure protein | - |
| LF543_RS02640 (LF543_02600) | - | 513357..513776 (+) | 420 | WP_010021652.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LF543_RS02645 (LF543_02605) | - | 513769..514140 (+) | 372 | WP_056936271.1 | DUF806 family protein | - |
| LF543_RS02650 (LF543_02610) | - | 514156..514749 (+) | 594 | WP_010021650.1 | major tail protein | - |
| LF543_RS02655 (LF543_02615) | - | 514889..515305 (+) | 417 | WP_010021649.1 | phage tail tube assembly chaperone | - |
| LF543_RS02660 | - | 515362..515520 (+) | 159 | WP_010021648.1 | hypothetical protein | - |
| LF543_RS02665 (LF543_02620) | - | 515537..520321 (+) | 4785 | WP_010021647.1 | tape measure protein | - |
| LF543_RS02670 (LF543_02625) | - | 520321..521160 (+) | 840 | WP_010021644.1 | phage tail domain-containing protein | - |
| LF543_RS02675 (LF543_02630) | - | 521172..522401 (+) | 1230 | WP_010021643.1 | hypothetical protein | - |
| LF543_RS02680 (LF543_02635) | - | 522401..524188 (+) | 1788 | WP_010021641.1 | phage tail protein | - |
| LF543_RS02685 (LF543_02640) | - | 524201..524740 (+) | 540 | WP_010021639.1 | hypothetical protein | - |
| LF543_RS02690 (LF543_02645) | - | 524740..525255 (+) | 516 | WP_010021638.1 | hypothetical protein | - |
| LF543_RS02695 (LF543_02650) | - | 525270..525773 (+) | 504 | WP_010021636.1 | hypothetical protein | - |
| LF543_RS02700 (LF543_02655) | - | 525790..526185 (+) | 396 | WP_010021635.1 | hypothetical protein | - |
| LF543_RS02705 (LF543_02660) | - | 526188..526334 (+) | 147 | WP_010021634.1 | XkdX family protein | - |
| LF543_RS07040 | - | 526381..526668 (+) | 288 | WP_010021633.1 | hypothetical protein | - |
| LF543_RS02715 (LF543_02670) | - | 526649..526921 (+) | 273 | WP_010021632.1 | hypothetical protein | - |
| LF543_RS02720 (LF543_02675) | - | 526905..527840 (+) | 936 | WP_010021630.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 140 a.a. Molecular weight: 15606.09 Da Isoelectric Point: 4.8538
>NTDB_id=395164 LF543_RS02565 WP_010021672.1 502144..502566(+) (ssb) [Fructilactobacillus fructivorans strain LF543]
MINTTVFTGRVTKALEVRQTSNGKSVGSVNLAVNRNFKNQDGNYDADFPMLQFWGKMADNFAKYTSKGSLVGIEGRLQTR
NYEDKNGNRVYVTEIVVNNFTLLDSKNNNNQSNNSNPFENPSAPTNNTGEPEISDDDLPF
MINTTVFTGRVTKALEVRQTSNGKSVGSVNLAVNRNFKNQDGNYDADFPMLQFWGKMADNFAKYTSKGSLVGIEGRLQTR
NYEDKNGNRVYVTEIVVNNFTLLDSKNNNNQSNNSNPFENPSAPTNNTGEPEISDDDLPF
Nucleotide
Download Length: 423 bp
>NTDB_id=395164 LF543_RS02565 WP_010021672.1 502144..502566(+) (ssb) [Fructilactobacillus fructivorans strain LF543]
ATGATTAATACTACGGTTTTTACAGGAAGAGTTACTAAAGCTCTAGAAGTTAGACAAACTAGCAATGGGAAAAGCGTTGG
CAGTGTAAATTTAGCCGTTAATCGTAATTTTAAAAATCAAGACGGCAATTACGATGCTGACTTTCCGATGTTGCAATTCT
GGGGAAAGATGGCAGATAACTTTGCCAAATATACGAGTAAAGGTTCATTAGTCGGAATTGAAGGTAGACTACAAACCCGC
AATTATGAAGATAAAAATGGTAATCGAGTTTATGTTACTGAGATTGTGGTTAACAATTTCACGTTGCTAGATTCCAAAAA
TAATAACAACCAATCTAATAACAGTAATCCATTTGAAAATCCAAGTGCACCTACTAATAATACTGGTGAACCTGAGATTT
CTGATGATGATCTTCCGTTTTAA
ATGATTAATACTACGGTTTTTACAGGAAGAGTTACTAAAGCTCTAGAAGTTAGACAAACTAGCAATGGGAAAAGCGTTGG
CAGTGTAAATTTAGCCGTTAATCGTAATTTTAAAAATCAAGACGGCAATTACGATGCTGACTTTCCGATGTTGCAATTCT
GGGGAAAGATGGCAGATAACTTTGCCAAATATACGAGTAAAGGTTCATTAGTCGGAATTGAAGGTAGACTACAAACCCGC
AATTATGAAGATAAAAATGGTAATCGAGTTTATGTTACTGAGATTGTGGTTAACAATTTCACGTTGCTAGATTCCAAAAA
TAATAACAACCAATCTAATAACAGTAATCCATTTGAAAATCCAAGTGCACCTACTAATAATACTGGTGAACCTGAGATTT
CTGATGATGATCTTCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.882 |
100 |
0.557 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
39.655 |
100 |
0.493 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.286 |
100 |
0.393 |
| ssbA | Streptococcus mutans UA159 |
37.857 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.143 |
100 |
0.371 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.429 |
100 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.429 |
100 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.429 |
100 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.429 |
100 |
0.364 |