Detailed information NTG0039512

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SPSINT_RS06265
• Genome accession: NC_014925
• Coordinates: 1306383..1306706 (-)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius HKU10-03
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1301383..1311706

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPSINT_RS06230 (SPSINT_1232)	gcvPA	1301967..1303316 (-)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SPSINT_RS06235 (SPSINT_1233)	gcvT	1303329..1304420 (-)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
SPSINT_RS06240 (SPSINT_1234)	-	1304578..1305105 (-)	528	WP_014613826.1	shikimate kinase	-
SPSINT_RS13435 (SPSINT_1235)	-	1305269..1305754 (-)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
SPSINT_RS06255 (SPSINT_1236)	-	1305660..1305860 (-)	201	WP_238402310.1	hypothetical protein	-
SPSINT_RS06260 (SPSINT_1237)	comGD	1305965..1306405 (-)	441	WP_015729164.1	competence type IV pilus minor pilin ComGD	-
SPSINT_RS06265 (SPSINT_1238)	comGC	1306383..1306706 (-)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
SPSINT_RS06270 (SPSINT_1239)	comGB	1306719..1307786 (-)	1068	WP_015729166.1	competence type IV pilus assembly protein ComGB	-
SPSINT_RS06275 (SPSINT_1240)	-	1307755..1308291 (-)	537	Protein_1258	ATPase, T2SS/T4P/T4SS family	-
SPSINT_RS06280 (SPSINT_1241)	-	1308392..1308898 (-)	507	WP_198463136.1	IbrB-like domain-containing protein	-
SPSINT_RS06285 (SPSINT_1242)	-	1308892..1310181 (-)	1290	WP_049770165.1	DUF3440 domain-containing protein	-
SPSINT_RS06290 (SPSINT_1243)	-	1310181..1311332 (-)	1152	WP_015729170.1	SNF2-related protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=39512 SPSINT_RS06265 WP_015729165.1 1306383..1306706(-) (comGC) [Staphylococcus pseudintermedius HKU10-03]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=39512 SPSINT_RS06265 WP_015729165.1 1306383..1306706(-) (comGC) [Staphylococcus pseudintermedius HKU10-03]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374