Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | D1010_RS00305 | Genome accession | NZ_CP045143 |
| Coordinates | 66428..66865 (+) | Length | 145 a.a. |
| NCBI ID | WP_027828809.1 | Uniprot ID | A0A0R1XHW9 |
| Organism | Schleiferilactobacillus harbinensis strain M1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 37492..111380 | 66428..66865 | within | 0 |
Gene organization within MGE regions
Location: 37492..111380
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1010_RS00175 (D1010_00175) | - | 37522..38052 (+) | 531 | WP_152259980.1 | hypothetical protein | - |
| D1010_RS00180 (D1010_00180) | - | 38049..38516 (+) | 468 | WP_152259981.1 | zinc ribbon domain-containing protein | - |
| D1010_RS00185 (D1010_00185) | - | 38681..39538 (+) | 858 | WP_193312131.1 | heparinase II/III family protein | - |
| D1010_RS00190 (D1010_00190) | - | 39493..40626 (+) | 1134 | WP_152259983.1 | heparinase II/III family protein | - |
| D1010_RS00195 (D1010_00195) | - | 40852..41667 (+) | 816 | WP_146993935.1 | hypothetical protein | - |
| D1010_RS00200 (D1010_00200) | - | 41779..42786 (-) | 1008 | WP_152259984.1 | serine hydrolase | - |
| D1010_RS00205 (D1010_00205) | - | 42803..44632 (-) | 1830 | WP_152259985.1 | DMT family transporter | - |
| D1010_RS00210 (D1010_00210) | - | 44809..45551 (+) | 743 | Protein_41 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| D1010_RS00215 (D1010_00215) | - | 45557..46870 (+) | 1314 | WP_152259986.1 | APC family permease | - |
| D1010_RS00220 (D1010_00220) | - | 46875..47684 (+) | 810 | WP_152259987.1 | GNAT family N-acetyltransferase | - |
| D1010_RS00225 (D1010_00225) | - | 47752..48171 (-) | 420 | WP_226911032.1 | YjdF family protein | - |
| D1010_RS00230 (D1010_00230) | - | 48439..48834 (+) | 396 | WP_152259989.1 | hypothetical protein | - |
| D1010_RS00235 (D1010_00235) | arsC | 48876..49283 (+) | 408 | WP_152259990.1 | arsenate reductase (thioredoxin) | - |
| D1010_RS18860 | - | 49465..49524 (-) | 60 | WP_220095855.1 | hypothetical protein | - |
| D1010_RS00240 (D1010_00240) | - | 49773..51011 (-) | 1239 | WP_152259991.1 | S41 family peptidase | - |
| D1010_RS00245 (D1010_00245) | - | 51116..52015 (+) | 900 | WP_193312132.1 | helix-turn-helix domain-containing protein | - |
| D1010_RS00250 (D1010_00250) | - | 52181..53815 (+) | 1635 | WP_226911033.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| D1010_RS00255 (D1010_00255) | - | 54178..55383 (+) | 1206 | WP_152259993.1 | RNA-guided endonuclease TnpB family protein | - |
| D1010_RS18865 | - | 55615..55665 (+) | 51 | WP_405127572.1 | hypothetical protein | - |
| D1010_RS00260 (D1010_00260) | abc-f | 55836..57419 (-) | 1584 | WP_152259994.1 | ribosomal protection-like ABC-F family protein | - |
| D1010_RS00265 (D1010_00265) | recQ | 57759..59582 (+) | 1824 | WP_405127553.1 | DNA helicase RecQ | - |
| D1010_RS00270 (D1010_00270) | - | 59545..61164 (-) | 1620 | WP_193312133.1 | ABC transporter ATP-binding protein | - |
| D1010_RS00275 (D1010_00275) | - | 61262..62242 (+) | 981 | WP_150392788.1 | helix-turn-helix domain-containing protein | - |
| D1010_RS00280 (D1010_00280) | - | 62256..63869 (-) | 1614 | WP_152259997.1 | ABC transporter ATP-binding protein | - |
| D1010_RS00285 (D1010_00285) | - | 63982..64959 (+) | 978 | WP_150392790.1 | helix-turn-helix domain-containing protein | - |
| D1010_RS00290 (D1010_00290) | rpsF | 65112..65405 (+) | 294 | WP_027828812.1 | 30S ribosomal protein S6 | - |
| D1010_RS00295 (D1010_00295) | ssb | 65438..66025 (+) | 588 | WP_063516798.1 | single-stranded DNA-binding protein | Machinery gene |
| D1010_RS00300 (D1010_00300) | rpsR | 66069..66308 (+) | 240 | WP_027828810.1 | 30S ribosomal protein S18 | - |
| D1010_RS00305 (D1010_00305) | ssb | 66428..66865 (+) | 438 | WP_027828809.1 | single-stranded DNA-binding protein | Machinery gene |
| D1010_RS00310 (D1010_00310) | - | 66933..67556 (-) | 624 | WP_152259998.1 | hypothetical protein | - |
| D1010_RS00315 (D1010_00315) | - | 67913..69145 (+) | 1233 | WP_152259999.1 | IS110 family transposase | - |
| D1010_RS00320 (D1010_00320) | - | 69434..69634 (-) | 201 | WP_027828808.1 | cold-shock protein | - |
| D1010_RS00325 (D1010_00325) | - | 69960..70736 (-) | 777 | WP_152260000.1 | sulfite exporter TauE/SafE family protein | - |
| D1010_RS00330 (D1010_00330) | - | 70848..71444 (+) | 597 | WP_152260001.1 | TMEM175 family protein | - |
| D1010_RS00335 (D1010_00335) | - | 71434..72213 (+) | 780 | WP_226911034.1 | hypothetical protein | - |
| D1010_RS00340 (D1010_00340) | - | 72198..73223 (-) | 1026 | WP_146995169.1 | NAD-dependent epimerase/dehydratase family protein | - |
| D1010_RS00345 (D1010_00345) | - | 73394..74764 (-) | 1371 | WP_152260002.1 | transposase | - |
| D1010_RS00350 (D1010_00350) | - | 74901..75356 (+) | 456 | WP_152260003.1 | MerR family transcriptional regulator | - |
| D1010_RS00355 (D1010_00355) | - | 75428..76360 (+) | 933 | WP_146995171.1 | ATP-binding cassette domain-containing protein | - |
| D1010_RS00360 (D1010_00360) | - | 76353..77066 (+) | 714 | WP_152260004.1 | ABC transporter permease | - |
| D1010_RS00365 (D1010_00365) | - | 77089..77802 (+) | 714 | WP_152260005.1 | ABC transporter permease | - |
| D1010_RS00370 (D1010_00370) | - | 77948..78448 (+) | 501 | WP_152260006.1 | EXLDI protein | - |
| D1010_RS00375 (D1010_00375) | - | 78496..79060 (+) | 565 | Protein_76 | TMEM175 family protein | - |
| D1010_RS00380 (D1010_00380) | - | 79090..79335 (+) | 246 | WP_063516802.1 | DUF3781 domain-containing protein | - |
| D1010_RS00385 (D1010_00385) | - | 79336..80040 (-) | 705 | WP_152260007.1 | M23 family metallopeptidase | - |
| D1010_RS00390 (D1010_00390) | - | 80077..80730 (-) | 654 | WP_152260008.1 | hypothetical protein | - |
| D1010_RS00395 (D1010_00395) | - | 80770..81696 (-) | 927 | WP_152260009.1 | sensor histidine kinase KdpD | - |
| D1010_RS00400 (D1010_00400) | - | 81699..82376 (-) | 678 | WP_152260010.1 | response regulator transcription factor | - |
| D1010_RS00405 (D1010_00405) | - | 82475..83374 (-) | 900 | WP_226911035.1 | agmatine deiminase family protein | - |
| D1010_RS17960 | - | 83623..83790 (-) | 168 | WP_193312134.1 | hypothetical protein | - |
| D1010_RS00410 (D1010_00410) | - | 83792..84274 (-) | 483 | WP_152260012.1 | NUDIX hydrolase | - |
| D1010_RS00415 (D1010_00415) | - | 84348..84731 (-) | 384 | WP_152260013.1 | hypothetical protein | - |
| D1010_RS00420 (D1010_00420) | sdaAB | 84937..85602 (+) | 666 | WP_152260014.1 | L-serine ammonia-lyase, iron-sulfur-dependent subunit beta | - |
| D1010_RS00425 (D1010_00425) | sdaAA | 85617..86486 (+) | 870 | WP_152260015.1 | L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha | - |
| D1010_RS00430 (D1010_00430) | - | 86483..86965 (+) | 483 | WP_152260016.1 | kinase | - |
| D1010_RS00435 (D1010_00435) | - | 87125..89137 (+) | 2013 | WP_146995182.1 | DHH family phosphoesterase | - |
| D1010_RS00440 (D1010_00440) | rplI | 89165..89620 (+) | 456 | WP_027828796.1 | 50S ribosomal protein L9 | - |
| D1010_RS00445 (D1010_00445) | dnaB | 89662..91071 (+) | 1410 | WP_027828795.1 | replicative DNA helicase | - |
| D1010_RS00450 (D1010_00450) | - | 91247..92551 (+) | 1305 | WP_027828794.1 | adenylosuccinate synthase | - |
| D1010_RS18870 | - | 92734..92802 (+) | 69 | Protein_93 | hypothetical protein | - |
| D1010_RS00460 (D1010_00460) | - | 92861..93613 (+) | 753 | WP_193312135.1 | ATP-binding cassette domain-containing protein | - |
| D1010_RS00465 (D1010_00465) | - | 93610..94362 (+) | 753 | WP_152260018.1 | ABC transporter permease | - |
| D1010_RS00470 (D1010_00470) | - | 94497..94865 (+) | 369 | WP_027828792.1 | PadR family transcriptional regulator | - |
| D1010_RS00475 (D1010_00475) | - | 94837..95670 (+) | 834 | WP_152260019.1 | hypothetical protein | - |
| D1010_RS00480 (D1010_00480) | - | 95810..96508 (+) | 699 | WP_152260020.1 | hypothetical protein | - |
| D1010_RS00485 (D1010_00485) | - | 96505..100419 (-) | 3915 | WP_152260021.1 | lectin-like domain-containing protein | - |
| D1010_RS00490 (D1010_00490) | - | 100641..101177 (+) | 537 | WP_063516101.1 | TetR/AcrR family transcriptional regulator | - |
| D1010_RS00495 (D1010_00495) | - | 101177..102235 (+) | 1059 | WP_152260022.1 | ABC transporter permease | - |
| D1010_RS00500 (D1010_00500) | - | 102250..102933 (+) | 684 | WP_027828787.1 | ABC transporter ATP-binding protein | - |
| D1010_RS00505 (D1010_00505) | - | 103068..103571 (+) | 504 | WP_152260023.1 | hypothetical protein | - |
| D1010_RS00510 (D1010_00510) | - | 103514..103858 (+) | 345 | WP_264371664.1 | CPBP family intramembrane glutamic endopeptidase | - |
| D1010_RS00515 (D1010_00515) | - | 103909..104532 (+) | 624 | WP_152260025.1 | SAP domain-containing protein | - |
| D1010_RS00520 (D1010_00520) | - | 104529..104858 (-) | 330 | WP_152260026.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| D1010_RS00525 (D1010_00525) | - | 104935..105120 (-) | 186 | WP_152260027.1 | hypothetical protein | - |
| D1010_RS00530 (D1010_00530) | - | 105304..106674 (+) | 1371 | WP_152260028.1 | transposase | - |
| D1010_RS00535 (D1010_00535) | - | 106746..107162 (-) | 417 | WP_152260029.1 | ABC-2 transporter permease | - |
| D1010_RS00540 (D1010_00540) | - | 107140..107880 (-) | 741 | WP_152260030.1 | ABC transporter ATP-binding protein | - |
| D1010_RS00545 (D1010_00545) | - | 107870..108331 (-) | 462 | WP_152260031.1 | helix-turn-helix domain-containing protein | - |
| D1010_RS00550 (D1010_00550) | - | 108527..108739 (+) | 213 | WP_027828781.1 | helix-turn-helix transcriptional regulator | - |
| D1010_RS00555 (D1010_00555) | - | 108736..109242 (+) | 507 | WP_152260032.1 | DUF3278 domain-containing protein | - |
| D1010_RS00560 (D1010_00560) | - | 109396..110157 (+) | 762 | WP_152260033.1 | CPBP family intramembrane glutamic endopeptidase | - |
| D1010_RS00565 (D1010_00565) | - | 110180..110869 (+) | 690 | WP_152260034.1 | CPBP family intramembrane glutamic endopeptidase | - |
| D1010_RS00570 (D1010_00570) | - | 110942..111172 (-) | 231 | WP_063516456.1 | CsbD family protein | - |
| D1010_RS00575 (D1010_00575) | - | 111207..111380 (-) | 174 | WP_082231185.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15786.64 Da Isoelectric Point: 4.9527
>NTDB_id=392299 D1010_RS00305 WP_027828809.1 66428..66865(+) (ssb) [Schleiferilactobacillus harbinensis strain M1]
MINRVTLVGRLVRDVELKYTPGGTARAWFNLAVTRNFKNANGERDSDFIECTVWGKSAESFVNFTCKGSLVGIEGQIRTR
SYEKDGQKVYASAVSVDSFALLESKAITDARRAGQPVTTAGKDDNVFVAAGNGENIDIADDDLPF
MINRVTLVGRLVRDVELKYTPGGTARAWFNLAVTRNFKNANGERDSDFIECTVWGKSAESFVNFTCKGSLVGIEGQIRTR
SYEKDGQKVYASAVSVDSFALLESKAITDARRAGQPVTTAGKDDNVFVAAGNGENIDIADDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=392299 D1010_RS00305 WP_027828809.1 66428..66865(+) (ssb) [Schleiferilactobacillus harbinensis strain M1]
ATGATTAATCGGGTAACGCTGGTGGGCCGCTTGGTGCGGGATGTGGAGTTAAAGTATACGCCGGGCGGAACTGCGCGGGC
ATGGTTCAATCTGGCAGTGACGCGTAATTTTAAGAACGCCAACGGTGAACGGGATTCTGATTTTATCGAATGTACGGTAT
GGGGCAAGTCGGCGGAATCATTTGTCAACTTCACCTGCAAGGGTTCTCTGGTGGGAATTGAGGGCCAAATCCGGACGCGC
AGCTATGAGAAAGATGGTCAGAAAGTTTACGCCTCGGCAGTCTCGGTGGATAGTTTTGCCCTCCTGGAATCAAAGGCCAT
AACTGACGCCCGGCGTGCTGGCCAGCCAGTAACAACTGCTGGAAAAGACGACAACGTCTTCGTCGCCGCGGGCAATGGCG
AAAACATCGACATCGCCGATGACGACCTGCCATTTTAA
ATGATTAATCGGGTAACGCTGGTGGGCCGCTTGGTGCGGGATGTGGAGTTAAAGTATACGCCGGGCGGAACTGCGCGGGC
ATGGTTCAATCTGGCAGTGACGCGTAATTTTAAGAACGCCAACGGTGAACGGGATTCTGATTTTATCGAATGTACGGTAT
GGGGCAAGTCGGCGGAATCATTTGTCAACTTCACCTGCAAGGGTTCTCTGGTGGGAATTGAGGGCCAAATCCGGACGCGC
AGCTATGAGAAAGATGGTCAGAAAGTTTACGCCTCGGCAGTCTCGGTGGATAGTTTTGCCCTCCTGGAATCAAAGGCCAT
AACTGACGCCCGGCGTGCTGGCCAGCCAGTAACAACTGCTGGAAAAGACGACAACGTCTTCGTCGCCGCGGGCAATGGCG
AAAACATCGACATCGCCGATGACGACCTGCCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.235 |
100 |
0.566 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.49 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40 |
100 |
0.4 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.552 |
100 |
0.366 |