Detailed information NTG0388855

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: F5989_RS07445
• Genome accession: NZ_CP044221
• Coordinates: 1502835..1503149 (+)
• Length: 104 a.a.
• NCBI ID: WP_002263437.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain NCH105
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1497835..1508149

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
F5989_RS07430 (F5989_07565)	-	1500414..1500797 (+)	384	WP_002264248.1	DUF1033 family protein	-
F5989_RS07435 (F5989_07570)	comYA	1500927..1501868 (+)	942	WP_002263435.1	competence type IV pilus ATPase ComGA	Machinery gene
F5989_RS07440 (F5989_07575)	comYB	1501804..1502835 (+)	1032	WP_255262721.1	competence type IV pilus assembly protein ComGB	Machinery gene
F5989_RS07445 (F5989_07580)	comYC	1502835..1503149 (+)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
F5989_RS07450 (F5989_07585)	comYD	1503136..1503540 (+)	405	WP_002264246.1	competence type IV pilus minor pilin ComGD	Machinery gene
F5989_RS07455 (F5989_07590)	comYE	1503512..1503805 (+)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
F5989_RS07460 (F5989_07595)	comYF	1503792..1504226 (+)	435	WP_061046398.1	competence type IV pilus minor pilin ComGF	Machinery gene
F5989_RS07465 (F5989_07600)	comYG	1504204..1504593 (+)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
F5989_RS07470 (F5989_07605)	comYH	1504648..1505601 (+)	954	WP_002263442.1	class I SAM-dependent methyltransferase	Machinery gene
F5989_RS07475 (F5989_07610)	-	1505660..1506859 (+)	1200	WP_002263443.1	acetate kinase	-
F5989_RS07480 (F5989_07615)	-	1507412..1507657 (+)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-
F5989_RS07485 (F5989_07620)	-	1507626..1508066 (+)	441	WP_002263445.1	hypothetical protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11591.60 Da
• Isoelectric Point: 10.2206

>NTDB_id=388855 F5989_RS07445 WP_002263437.1 1502835..1503149(+) (comYC) [Streptococcus mutans strain NCH105]
MKKIKRVSVRAFTLIEMLVVLLIISILLLLFVPNLTKQKDKVKDTGGSAVVKVVESQAELYELNKTDSATLSKLVASGDI
TQEQANSYKDYYAKHPSKTRHVAN

Nucleotide

• Length: 315 bp

>NTDB_id=388855 F5989_RS07445 WP_002263437.1 1502835..1503149(+) (comYC) [Streptococcus mutans strain NCH105]
ATGAAAAAGATCAAGAGAGTCAGTGTACGAGCTTTTACGCTTATAGAAATGTTAGTAGTTCTTCTCATTATTAGTATTCT
TTTACTATTATTTGTTCCTAATTTAACTAAGCAAAAAGATAAGGTAAAAGATACTGGCGGTTCTGCCGTGGTTAAAGTTG
TAGAAAGTCAGGCTGAGCTTTATGAGCTTAATAAAACCGATTCTGCTACTCTTTCTAAATTAGTAGCTAGTGGTGATATT
ACACAAGAACAGGCAAATTCATACAAGGATTACTATGCAAAACACCCAAGTAAAACACGGCATGTCGCGAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	100	100	1
comYC	Streptococcus mutans UA159	100	100	1
comYC	Streptococcus gordonii str. Challis substr. CH1	71.429	100	0.721
comGC/cglC	Streptococcus mitis SK321	66.667	95.192	0.635
comGC/cglC	Streptococcus mitis NCTC 12261	69.565	88.462	0.615
comGC/cglC	Streptococcus pneumoniae R6	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae Rx1	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae D39	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae TIGR4	63.636	95.192	0.606
comGC	Lactococcus lactis subsp. cremoris KW2	55.446	97.115	0.538
comYC	Streptococcus suis isolate S10	60.227	84.615	0.51