Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | FZC51_RS03570 | Genome accession | NZ_CP043389 |
| Coordinates | 741212..741523 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NRS384-rpoB-H481N-SCV | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 736212..746523
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FZC51_RS03540 (FZC51_03540) | - | 736995..737198 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| FZC51_RS03545 (FZC51_03545) | - | 737195..738181 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| FZC51_RS03550 (FZC51_03550) | - | 738181..738510 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| FZC51_RS03555 (FZC51_03555) | - | 738507..739130 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| FZC51_RS03560 (FZC51_03560) | comGA | 739182..740156 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| FZC51_RS03565 (FZC51_03565) | comGB | 740128..741198 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| FZC51_RS03570 (FZC51_03570) | comGC | 741212..741523 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FZC51_RS03575 (FZC51_03575) | comGD | 741501..741947 (+) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| FZC51_RS03580 (FZC51_03580) | comGE | 741934..742233 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| FZC51_RS03585 (FZC51_03585) | comGF | 742151..742648 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| FZC51_RS03590 (FZC51_03590) | - | 742745..742891 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| FZC51_RS03595 (FZC51_03595) | - | 742881..743405 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| FZC51_RS03600 (FZC51_03600) | gcvT | 743564..744655 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FZC51_RS03605 (FZC51_03605) | gcvPA | 744675..746021 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=383208 FZC51_RS03570 WP_000472256.1 741212..741523(+) (comGC) [Staphylococcus aureus strain NRS384-rpoB-H481N-SCV]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=383208 FZC51_RS03570 WP_000472256.1 741212..741523(+) (comGC) [Staphylococcus aureus strain NRS384-rpoB-H481N-SCV]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |