Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | EJF26_RS07220 | Genome accession | NZ_CP034442 |
| Coordinates | 1444137..1444262 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799680.1 | Uniprot ID | A0A428FUE9 |
| Organism | Streptococcus oralis subsp. dentisani strain F0392 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1439137..1449262
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJF26_RS07195 | - | 1441263..1441805 (+) | 543 | WP_000665076.1 | TetR/AcrR family transcriptional regulator | - |
| EJF26_RS07210 | comE | 1442047..1442799 (-) | 753 | WP_000866080.1 | competence system response regulator transcription factor ComE | Regulator |
| EJF26_RS07215 | comD | 1442796..1444115 (-) | 1320 | WP_001048121.1 | competence system sensor histidine kinase ComD | Regulator |
| EJF26_RS07220 | comC | 1444137..1444262 (-) | 126 | WP_000799680.1 | competence-stimulating peptide ComC | Regulator |
| EJF26_RS07230 | rlmH | 1444546..1445025 (-) | 480 | WP_000694224.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| EJF26_RS07235 | htrA | 1445209..1446399 (+) | 1191 | WP_000681818.1 | S1C family serine protease | Regulator |
| EJF26_RS07240 | spo0J | 1446457..1447215 (+) | 759 | WP_004246572.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| EJF26_RS07245 | dnaA | 1447438..1448799 (+) | 1362 | WP_004245972.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4998.87 Da Isoelectric Point: 10.1884
>NTDB_id=331370 EJF26_RS07220 WP_000799680.1 1444137..1444262(-) (comC) [Streptococcus oralis subsp. dentisani strain F0392]
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
Nucleotide
Download Length: 126 bp
>NTDB_id=331370 EJF26_RS07220 WP_000799680.1 1444137..1444262(-) (comC) [Streptococcus oralis subsp. dentisani strain F0392]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis SK321 |
58.537 |
100 |
0.585 |
| comC/comC2 | Streptococcus pneumoniae A66 |
53.659 |
100 |
0.537 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |