Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | FF957_RS08020 | Genome accession | NZ_CP040619 |
| Coordinates | 1610164..1610475 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain J01 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1605164..1615475
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF957_RS07985 (FF957_07985) | gcvPA | 1605666..1607012 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| FF957_RS07990 (FF957_07990) | gcvT | 1607032..1608123 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FF957_RS07995 (FF957_07995) | - | 1608282..1608806 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| FF957_RS08000 (FF957_08000) | - | 1608796..1608942 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| FF957_RS08005 (FF957_08005) | comGF | 1609039..1609536 (-) | 498 | WP_138642962.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| FF957_RS08010 (FF957_08010) | comGE | 1609454..1609753 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| FF957_RS08015 (FF957_08015) | comGD | 1609740..1610186 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| FF957_RS08020 (FF957_08020) | comGC | 1610164..1610475 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FF957_RS08025 (FF957_08025) | comGB | 1610489..1611559 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| FF957_RS08030 (FF957_08030) | comGA | 1611531..1612505 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| FF957_RS08035 (FF957_08035) | - | 1612557..1613180 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| FF957_RS08040 (FF957_08040) | - | 1613177..1613506 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| FF957_RS08045 (FF957_08045) | - | 1613506..1614492 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| FF957_RS08050 (FF957_08050) | - | 1614489..1614692 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=322284 FF957_RS08020 WP_000472256.1 1610164..1610475(-) (comGC) [Staphylococcus aureus strain J01]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=322284 FF957_RS08020 WP_000472256.1 1610164..1610475(-) (comGC) [Staphylococcus aureus strain J01]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |