Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LL267_RS11365 | Genome accession | NZ_CP032058 |
| Coordinates | 2218279..2218548 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain 267 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2215323..2253365 | 2218279..2218548 | within | 0 |
Gene organization within MGE regions
Location: 2215323..2253365
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL267_RS11340 (LL267_2178) | - | 2215932..2216879 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LL267_RS11345 (LL267_2179) | comGG | 2216853..2217179 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL267_RS11350 (LL267_2180) | comGF | 2217229..2217657 (-) | 429 | Protein_2210 | competence type IV pilus minor pilin ComGF | - |
| LL267_RS11355 (LL267_2181) | comGE | 2217620..2217916 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL267_RS11360 (LL267_2182) | comGD | 2217888..2218319 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LL267_RS11365 (LL267_2183) | comGC | 2218279..2218548 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LL267_RS11370 (LL267_2184) | - | 2218675..2219367 (-) | 693 | WP_152994386.1 | hypothetical protein | - |
| LL267_RS11375 (LL267_2185) | - | 2219609..2220388 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| LL267_RS11380 (LL267_2186) | - | 2220388..2220687 (-) | 300 | WP_031559226.1 | phage holin | - |
| LL267_RS11385 (LL267_2187) | - | 2220700..2221050 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LL267_RS11390 (LL267_2188) | - | 2221063..2221299 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| LL267_RS11395 (LL267_2189) | - | 2221311..2225576 (-) | 4266 | WP_243525488.1 | hypothetical protein | - |
| LL267_RS11400 (LL267_2190) | - | 2225555..2227084 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| LL267_RS11405 (LL267_2191) | - | 2227094..2229703 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| LL267_RS11410 (LL267_2192) | - | 2229693..2230400 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| LL267_RS11415 (LL267_2193) | - | 2230416..2230823 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| LL267_RS11420 (LL267_2194) | - | 2230880..2231356 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LL267_RS11425 (LL267_2195) | - | 2231367..2231801 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LL267_RS11430 (LL267_2196) | - | 2231801..2232130 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LL267_RS11435 (LL267_2197) | - | 2232127..2232471 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LL267_RS11440 (LL267_2198) | - | 2232461..2232862 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LL267_RS11445 (LL267_2199) | - | 2232936..2233172 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LL267_RS11450 (LL267_2200) | - | 2233201..2234118 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LL267_RS11455 (LL267_2201) | - | 2234133..2235182 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| LL267_RS11460 (LL267_2202) | - | 2235198..2236028 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| LL267_RS11465 (LL267_2203) | - | 2236021..2237550 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| LL267_RS11470 (LL267_2204) | terL | 2237563..2239014 (-) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| LL267_RS11475 (LL267_2205) | - | 2238995..2239468 (-) | 474 | WP_058221398.1 | transposase | - |
| LL267_RS11480 (LL267_2206) | - | 2239639..2240028 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| LL267_RS11485 (LL267_2207) | - | 2240105..2240413 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| LL267_RS11490 (LL267_2208) | - | 2240542..2240757 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| LL267_RS11495 (LL267_2209) | - | 2240754..2240972 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| LL267_RS11500 (LL267_2210) | - | 2240991..2241710 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| LL267_RS11505 (LL267_2211) | - | 2241737..2242096 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| LL267_RS11510 (LL267_2212) | dut | 2242100..2242519 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| LL267_RS11515 (LL267_2213) | - | 2242516..2242881 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| LL267_RS11520 (LL267_2214) | - | 2242878..2243420 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| LL267_RS11525 (LL267_03080) | - | 2243413..2243595 (-) | 183 | WP_243525495.1 | hypothetical protein | - |
| LL267_RS11530 (LL267_03085) | - | 2243614..2243772 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| LL267_RS11535 (LL267_2216) | - | 2243964..2244170 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LL267_RS11540 (LL267_2217) | - | 2244278..2244688 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LL267_RS11545 (LL267_03090) | - | 2244701..2244973 (-) | 273 | WP_145952588.1 | L-rhamnose isomerase | - |
| LL267_RS11550 (LL267_2219) | - | 2245036..2245962 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LL267_RS11555 (LL267_2220) | - | 2246225..2247292 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| LL267_RS11560 (LL267_2221) | bet | 2247294..2248031 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| LL267_RS11565 (LL267_2222) | - | 2248138..2248314 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| LL267_RS11570 (LL267_2223) | - | 2248311..2248559 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| LL267_RS11575 (LL267_03095) | - | 2248572..2248694 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LL267_RS11580 (LL267_2224) | - | 2248691..2248873 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LL267_RS11585 (LL267_2225) | - | 2248889..2249578 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| LL267_RS11590 (LL267_2226) | - | 2249637..2249870 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| LL267_RS11595 (LL267_2227) | - | 2250047..2250457 (+) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| LL267_RS11600 (LL267_2228) | - | 2250468..2251052 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| LL267_RS11605 (LL267_2229) | - | 2251108..2251647 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LL267_RS11610 (LL267_2230) | - | 2251773..2253230 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=313491 LL267_RS11365 WP_003129998.1 2218279..2218548(-) (comGC) [Lactococcus lactis subsp. lactis strain 267]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=313491 LL267_RS11365 WP_003129998.1 2218279..2218548(-) (comGC) [Lactococcus lactis subsp. lactis strain 267]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comYC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comYC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comYC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |