Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LL267_RS11345 Genome accession   NZ_CP032058
Coordinates   2216853..2217179 (-) Length   108 a.a.
NCBI ID   WP_058221568.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain 267     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2215323..2253365 2216853..2217179 within 0


Gene organization within MGE regions


Location: 2215323..2253365
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL267_RS11340 (LL267_2178) - 2215932..2216879 (+) 948 WP_003130410.1 IS30 family transposase -
  LL267_RS11345 (LL267_2179) comGG 2216853..2217179 (-) 327 WP_058221568.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL267_RS11350 (LL267_2180) comGF 2217229..2217657 (-) 429 Protein_2210 competence type IV pilus minor pilin ComGF -
  LL267_RS11355 (LL267_2181) comGE 2217620..2217916 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL267_RS11360 (LL267_2182) comGD 2217888..2218319 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL267_RS11365 (LL267_2183) comGC 2218279..2218548 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  LL267_RS11370 (LL267_2184) - 2218675..2219367 (-) 693 WP_152994386.1 hypothetical protein -
  LL267_RS11375 (LL267_2185) - 2219609..2220388 (-) 780 WP_082225220.1 peptidoglycan amidohydrolase family protein -
  LL267_RS11380 (LL267_2186) - 2220388..2220687 (-) 300 WP_031559226.1 phage holin -
  LL267_RS11385 (LL267_2187) - 2220700..2221050 (-) 351 WP_014570798.1 hypothetical protein -
  LL267_RS11390 (LL267_2188) - 2221063..2221299 (-) 237 WP_082225257.1 hypothetical protein -
  LL267_RS11395 (LL267_2189) - 2221311..2225576 (-) 4266 WP_243525488.1 hypothetical protein -
  LL267_RS11400 (LL267_2190) - 2225555..2227084 (-) 1530 WP_003131327.1 distal tail protein Dit -
  LL267_RS11405 (LL267_2191) - 2227094..2229703 (-) 2610 WP_058221395.1 phage tail tape measure protein -
  LL267_RS11410 (LL267_2192) - 2229693..2230400 (-) 708 WP_003131324.1 Gp15 family bacteriophage protein -
  LL267_RS11415 (LL267_2193) - 2230416..2230823 (-) 408 WP_058221396.1 hypothetical protein -
  LL267_RS11420 (LL267_2194) - 2230880..2231356 (-) 477 WP_014570559.1 phage tail tube protein -
  LL267_RS11425 (LL267_2195) - 2231367..2231801 (-) 435 WP_003131321.1 minor capsid protein -
  LL267_RS11430 (LL267_2196) - 2231801..2232130 (-) 330 WP_003131320.1 hypothetical protein -
  LL267_RS11435 (LL267_2197) - 2232127..2232471 (-) 345 WP_014570557.1 putative minor capsid protein -
  LL267_RS11440 (LL267_2198) - 2232461..2232862 (-) 402 WP_014570556.1 hypothetical protein -
  LL267_RS11445 (LL267_2199) - 2232936..2233172 (-) 237 WP_014570555.1 Ig-like domain-containing protein -
  LL267_RS11450 (LL267_2200) - 2233201..2234118 (-) 918 WP_003131315.1 hypothetical protein -
  LL267_RS11455 (LL267_2201) - 2234133..2235182 (-) 1050 WP_003131314.1 XkdF-like putative serine protease domain-containing protein -
  LL267_RS11460 (LL267_2202) - 2235198..2236028 (-) 831 WP_003131311.1 phage minor head protein -
  LL267_RS11465 (LL267_2203) - 2236021..2237550 (-) 1530 WP_058221397.1 phage portal protein -
  LL267_RS11470 (LL267_2204) terL 2237563..2239014 (-) 1452 WP_014570551.1 phage terminase large subunit -
  LL267_RS11475 (LL267_2205) - 2238995..2239468 (-) 474 WP_058221398.1 transposase -
  LL267_RS11480 (LL267_2206) - 2239639..2240028 (-) 390 WP_058221399.1 DUF722 domain-containing protein -
  LL267_RS11485 (LL267_2207) - 2240105..2240413 (-) 309 WP_082225258.1 hypothetical protein -
  LL267_RS11490 (LL267_2208) - 2240542..2240757 (-) 216 WP_058221541.1 DUF1660 domain-containing protein -
  LL267_RS11495 (LL267_2209) - 2240754..2240972 (-) 219 WP_014570803.1 hypothetical protein -
  LL267_RS11500 (LL267_2210) - 2240991..2241710 (-) 720 WP_082225259.1 hypothetical protein -
  LL267_RS11505 (LL267_2211) - 2241737..2242096 (-) 360 WP_082225260.1 hypothetical protein -
  LL267_RS11510 (LL267_2212) dut 2242100..2242519 (-) 420 WP_082225261.1 dUTP diphosphatase -
  LL267_RS11515 (LL267_2213) - 2242516..2242881 (-) 366 WP_082225262.1 DUF1642 domain-containing protein -
  LL267_RS11520 (LL267_2214) - 2242878..2243420 (-) 543 WP_145952586.1 DUF1642 domain-containing protein -
  LL267_RS11525 (LL267_03080) - 2243413..2243595 (-) 183 WP_243525495.1 hypothetical protein -
  LL267_RS11530 (LL267_03085) - 2243614..2243772 (-) 159 WP_228763273.1 hypothetical protein -
  LL267_RS11535 (LL267_2216) - 2243964..2244170 (-) 207 WP_014570535.1 hypothetical protein -
  LL267_RS11540 (LL267_2217) - 2244278..2244688 (-) 411 WP_014570810.1 hypothetical protein -
  LL267_RS11545 (LL267_03090) - 2244701..2244973 (-) 273 WP_145952588.1 L-rhamnose isomerase -
  LL267_RS11550 (LL267_2219) - 2245036..2245962 (-) 927 WP_058221710.1 phage replisome organizer N-terminal domain-containing protein -
  LL267_RS11555 (LL267_2220) - 2246225..2247292 (-) 1068 WP_058221711.1 DUF1351 domain-containing protein -
  LL267_RS11560 (LL267_2221) bet 2247294..2248031 (-) 738 WP_058212836.1 phage recombination protein Bet -
  LL267_RS11565 (LL267_2222) - 2248138..2248314 (-) 177 WP_032943269.1 putative transcriptional regulator -
  LL267_RS11570 (LL267_2223) - 2248311..2248559 (-) 249 WP_058221712.1 hypothetical protein -
  LL267_RS11575 (LL267_03095) - 2248572..2248694 (-) 123 WP_023164646.1 hypothetical protein -
  LL267_RS11580 (LL267_2224) - 2248691..2248873 (-) 183 WP_003130605.1 hypothetical protein -
  LL267_RS11585 (LL267_2225) - 2248889..2249578 (-) 690 WP_058221713.1 Rha family transcriptional regulator -
  LL267_RS11590 (LL267_2226) - 2249637..2249870 (-) 234 WP_014570819.1 helix-turn-helix transcriptional regulator -
  LL267_RS11595 (LL267_2227) - 2250047..2250457 (+) 411 WP_014570820.1 helix-turn-helix domain-containing protein -
  LL267_RS11600 (LL267_2228) - 2250468..2251052 (+) 585 WP_058221714.1 hypothetical protein -
  LL267_RS11605 (LL267_2229) - 2251108..2251647 (+) 540 WP_023189015.1 PH domain-containing protein -
  LL267_RS11610 (LL267_2230) - 2251773..2253230 (+) 1458 WP_058221720.1 recombinase family protein -

Sequence

Protein


Download         Length: 108 a.a.        Molecular weight: 12234.69 Da        Isoelectric Point: 6.0669

>NTDB_id=313488 LL267_RS11345 WP_058221568.1 2216853..2217179(-) (comGG) [Lactococcus lactis subsp. lactis strain 267]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI

Nucleotide


Download         Length: 327 bp        

>NTDB_id=313488 LL267_RS11345 WP_058221568.1 2216853..2217179(-) (comGG) [Lactococcus lactis subsp. lactis strain 267]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.065

86.111

0.5

Multiple sequence alignment