Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | D1O27_RS06200 | Genome accession | NZ_CP031839 |
| Coordinates | 1151782..1152093 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NX-T55 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1146782..1157093
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1O27_RS06170 (D1O27_06170) | - | 1147565..1147768 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| D1O27_RS06175 (D1O27_06175) | - | 1147765..1148751 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| D1O27_RS06180 (D1O27_06180) | - | 1148751..1149080 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| D1O27_RS06185 (D1O27_06185) | - | 1149077..1149700 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| D1O27_RS06190 (D1O27_06190) | comGA | 1149752..1150726 (+) | 975 | WP_031587486.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| D1O27_RS06195 (D1O27_06195) | comGB | 1150698..1151768 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| D1O27_RS06200 (D1O27_06200) | comGC | 1151782..1152093 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| D1O27_RS06205 (D1O27_06205) | comGD | 1152071..1152517 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| D1O27_RS06210 (D1O27_06210) | comGE | 1152504..1152803 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| D1O27_RS06215 (D1O27_06215) | comGF | 1152721..1153218 (+) | 498 | WP_029694050.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| D1O27_RS06220 (D1O27_06220) | - | 1153315..1153461 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| D1O27_RS06225 (D1O27_06225) | - | 1153451..1153975 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| D1O27_RS06230 (D1O27_06230) | gcvT | 1154134..1155225 (+) | 1092 | WP_000093348.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D1O27_RS06235 (D1O27_06235) | gcvPA | 1155245..1156591 (+) | 1347 | WP_000019690.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=311733 D1O27_RS06200 WP_000472256.1 1151782..1152093(+) (comGC) [Staphylococcus aureus strain NX-T55]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=311733 D1O27_RS06200 WP_000472256.1 1151782..1152093(+) (comGC) [Staphylococcus aureus strain NX-T55]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |