Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO55_RS08295 | Genome accession | NZ_CP038268 |
| Coordinates | 1623568..1623879 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain O55 isolate B118 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1618568..1628879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO55_RS08260 (SaO55_1538) | gcvPA | 1619070..1620416 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO55_RS08265 (SaO55_1539) | gcvT | 1620436..1621527 (-) | 1092 | WP_000093354.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO55_RS08270 (SaO55_1540) | - | 1621686..1622210 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO55_RS08275 | - | 1622200..1622346 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO55_RS08280 (SaO55_1541) | comGF | 1622443..1622940 (-) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO55_RS08285 (SaO55_1542) | comGE | 1622858..1623157 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SaO55_RS08290 (SaO55_1543) | comGD | 1623144..1623590 (-) | 447 | WP_072357807.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO55_RS08295 (SaO55_1544) | comGC | 1623568..1623879 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO55_RS08300 (SaO55_1545) | comGB | 1623893..1624963 (-) | 1071 | WP_000776413.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO55_RS08305 (SaO55_1546) | comGA | 1624935..1625909 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO55_RS08310 (SaO55_1547) | - | 1625961..1626584 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO55_RS08315 (SaO55_1548) | - | 1626581..1626910 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO55_RS08320 | - | 1626910..1627896 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SaO55_RS08325 (SaO55_1550) | - | 1627893..1628096 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=310618 SaO55_RS08295 WP_000472256.1 1623568..1623879(-) (comGC) [Staphylococcus aureus strain O55 isolate B118]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=310618 SaO55_RS08295 WP_000472256.1 1623568..1623879(-) (comGC) [Staphylococcus aureus strain O55 isolate B118]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |