Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | DU470_RS07945 | Genome accession | NZ_CP031131 |
| Coordinates | 1578863..1579174 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain E16SA093 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1573863..1584174
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DU470_RS07910 (DU470_07910) | gcvPA | 1574365..1575711 (-) | 1347 | WP_000019681.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| DU470_RS07915 (DU470_07915) | gcvT | 1575731..1576822 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DU470_RS07920 (DU470_07920) | - | 1576981..1577505 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| DU470_RS07925 (DU470_07925) | - | 1577495..1577641 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| DU470_RS07930 (DU470_07930) | comGF | 1577738..1578235 (-) | 498 | WP_020978197.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| DU470_RS07935 (DU470_07935) | comGE | 1578153..1578452 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| DU470_RS07940 (DU470_07940) | comGD | 1578439..1578885 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| DU470_RS07945 (DU470_07945) | comGC | 1578863..1579174 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| DU470_RS07950 (DU470_07950) | comGB | 1579188..1580258 (-) | 1071 | WP_000776401.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| DU470_RS07955 (DU470_07955) | comGA | 1580230..1581204 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| DU470_RS07960 (DU470_07960) | - | 1581256..1581879 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| DU470_RS07965 (DU470_07965) | - | 1581876..1582205 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| DU470_RS07970 (DU470_07970) | - | 1582205..1583191 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| DU470_RS07975 (DU470_07975) | - | 1583188..1583391 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=303626 DU470_RS07945 WP_000472256.1 1578863..1579174(-) (comGC) [Staphylococcus aureus strain E16SA093]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=303626 DU470_RS07945 WP_000472256.1 1578863..1579174(-) (comGC) [Staphylococcus aureus strain E16SA093]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |