Detailed information NTG0301097

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DNH96_RS01475
• Genome accession: NZ_CP030715
• Coordinates: 318106..318429 (-)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain VB88
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 313106..323429

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DNH96_RS01445 (DNH96_01450)	gcvPA	313690..315039 (-)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
DNH96_RS01450 (DNH96_01455)	gcvT	315052..316143 (-)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
DNH96_RS01455 (DNH96_01460)	-	316301..316828 (-)	528	WP_014613826.1	shikimate kinase	-
DNH96_RS13200 (DNH96_01470)	-	316992..317477 (-)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
DNH96_RS01465 (DNH96_01475)	-	317383..317583 (-)	201	WP_020219623.1	hypothetical protein	-
DNH96_RS01470 (DNH96_01480)	comGD	317688..318128 (-)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
DNH96_RS01475 (DNH96_01485)	comGC	318106..318429 (-)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
DNH96_RS01480 (DNH96_01490)	comGB	318442..319509 (-)	1068	WP_014613821.1	competence type IV pilus assembly protein ComGB	-
DNH96_RS01485 (DNH96_01495)	comGA	319478..320452 (-)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
DNH96_RS01490 (DNH96_01500)	-	320613..321242 (-)	630	WP_096535719.1	MBL fold metallo-hydrolase	-
DNH96_RS01495 (DNH96_01505)	-	321255..321566 (-)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
DNH96_RS01500 (DNH96_01510)	-	321567..322553 (-)	987	WP_065520488.1	ROK family glucokinase	-
DNH96_RS01505 (DNH96_01515)	-	322550..322753 (-)	204	WP_014613816.1	YqgQ family protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=301097 DNH96_RS01475 WP_015729165.1 318106..318429(-) (comGC) [Staphylococcus pseudintermedius strain VB88]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=301097 DNH96_RS01475 WP_015729165.1 318106..318429(-) (comGC) [Staphylococcus pseudintermedius strain VB88]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374