Detailed information NTG0301077

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DNH82_RS08805
• Genome accession: NZ_CP030374
• Coordinates: 1923735..1924058 (-)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain AH18
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1918735..1929058

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DNH82_RS08775 (DNH82_08895)	gcvPA	1919319..1920668 (-)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
DNH82_RS08780 (DNH82_08900)	gcvT	1920681..1921772 (-)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
DNH82_RS08785 (DNH82_08905)	-	1921930..1922457 (-)	528	WP_096533266.1	shikimate kinase	-
DNH82_RS12955 (DNH82_08915)	-	1922621..1923106 (-)	486	WP_096533267.1	competence type IV pilus minor pilin ComGF	-
DNH82_RS08795 (DNH82_08920)	-	1923012..1923212 (-)	201	WP_020219623.1	hypothetical protein	-
DNH82_RS08800 (DNH82_08925)	comGD	1923317..1923757 (-)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
DNH82_RS08805 (DNH82_08930)	comGC	1923735..1924058 (-)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
DNH82_RS08810 (DNH82_08935)	comGB	1924071..1925138 (-)	1068	WP_063284398.1	competence type IV pilus assembly protein ComGB	-
DNH82_RS08815 (DNH82_08940)	comGA	1925107..1926081 (-)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
DNH82_RS08820 (DNH82_08945)	-	1926241..1926870 (-)	630	WP_190000113.1	MBL fold metallo-hydrolase	-
DNH82_RS08825 (DNH82_08950)	-	1926883..1927194 (-)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
DNH82_RS08830 (DNH82_08955)	-	1927195..1928181 (-)	987	WP_014613817.1	ROK family glucokinase	-
DNH82_RS08835 (DNH82_08960)	-	1928178..1928381 (-)	204	WP_014613816.1	YqgQ family protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=301077 DNH82_RS08805 WP_015729165.1 1923735..1924058(-) (comGC) [Staphylococcus pseudintermedius strain AH18]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=301077 DNH82_RS08805 WP_015729165.1 1923735..1924058(-) (comGC) [Staphylococcus pseudintermedius strain AH18]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374