Detailed information
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | DM611_RS17690 | Genome accession | NZ_CP029773 |
| Coordinates | 3795544..3795969 (-) | Length | 141 a.a. |
| NCBI ID | WP_110714370.1 | Uniprot ID | - |
| Organism | Stenotrophomonas maltophilia strain SJTL3 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3782682..3811575 | 3795544..3795969 | within | 0 |
Gene organization within MGE regions
Location: 3782682..3811575
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DM611_RS17640 (DM611_17640) | - | 3782682..3783356 (+) | 675 | WP_162622086.1 | hypothetical protein | - |
| DM611_RS17645 (DM611_17645) | - | 3783350..3784363 (+) | 1014 | WP_049447473.1 | hypothetical protein | - |
| DM611_RS17650 (DM611_17650) | - | 3784357..3785373 (+) | 1017 | WP_110713347.1 | TraB/GumN family protein | - |
| DM611_RS17655 (DM611_17655) | - | 3785692..3785961 (+) | 270 | WP_110713349.1 | hypothetical protein | - |
| DM611_RS17660 (DM611_17660) | - | 3786013..3787770 (+) | 1758 | WP_110713350.1 | ABC transporter transmembrane domain-containing protein | - |
| DM611_RS17665 (DM611_17665) | sucD | 3787888..3788763 (-) | 876 | WP_005410793.1 | succinate--CoA ligase subunit alpha | - |
| DM611_RS17670 (DM611_17670) | sucC | 3788784..3789953 (-) | 1170 | WP_004154430.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| DM611_RS17675 (DM611_17675) | - | 3790359..3791972 (+) | 1614 | WP_110713352.1 | ATP-binding protein | - |
| DM611_RS17680 (DM611_17680) | pilR | 3792033..3793406 (+) | 1374 | WP_110713353.1 | sigma-54 dependent transcriptional regulator | Regulator |
| DM611_RS17685 (DM611_17685) | pilB | 3793533..3795263 (-) | 1731 | WP_110713355.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| DM611_RS17690 (DM611_17690) | comP | 3795544..3795969 (-) | 426 | WP_110714370.1 | pilin | Machinery gene |
| DM611_RS17695 (DM611_17695) | pilC | 3796324..3797583 (+) | 1260 | WP_110713357.1 | type II secretion system F family protein | Machinery gene |
| DM611_RS17700 (DM611_17700) | - | 3797592..3798455 (+) | 864 | WP_110713358.1 | A24 family peptidase | - |
| DM611_RS17705 (DM611_17705) | coaE | 3798467..3799078 (+) | 612 | WP_110713359.1 | dephospho-CoA kinase | - |
| DM611_RS17710 (DM611_17710) | - | 3799208..3799594 (-) | 387 | WP_110713361.1 | hypothetical protein | - |
| DM611_RS17715 (DM611_17715) | - | 3800019..3802091 (-) | 2073 | WP_162622087.1 | DUF2235 domain-containing protein | - |
| DM611_RS17720 (DM611_17720) | - | 3802187..3802804 (-) | 618 | WP_110713364.1 | DUF3304 domain-containing protein | - |
| DM611_RS17725 (DM611_17725) | - | 3802805..3803560 (-) | 756 | WP_343126107.1 | DUF2235 domain-containing protein | - |
| DM611_RS17730 (DM611_17730) | - | 3803941..3804549 (-) | 609 | WP_162622089.1 | DUF3304 domain-containing protein | - |
| DM611_RS17735 (DM611_17735) | - | 3804740..3805555 (-) | 816 | WP_110713369.1 | DUF4123 domain-containing protein | - |
| DM611_RS17740 (DM611_17740) | tssI | 3805548..3808157 (-) | 2610 | WP_110713371.1 | type VI secretion system tip protein TssI/VgrG | - |
| DM611_RS17745 (DM611_17745) | - | 3808380..3808796 (-) | 417 | WP_110713373.1 | hypothetical protein | - |
| DM611_RS17750 (DM611_17750) | - | 3809067..3810437 (-) | 1371 | WP_110713374.1 | HAMP domain-containing sensor histidine kinase | - |
| DM611_RS17755 (DM611_17755) | - | 3810400..3811077 (-) | 678 | WP_005410804.1 | response regulator transcription factor | - |
| DM611_RS17760 (DM611_17760) | - | 3811090..3811575 (-) | 486 | WP_110713376.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 14652.87 Da Isoelectric Point: 7.6315
>NTDB_id=296017 DM611_RS17690 WP_110714370.1 3795544..3795969(-) (comP) [Stenotrophomonas maltophilia strain SJTL3]
MKNQKGFTLIELMIVVAIIAILAAIALPAYRDYTVRAKVSESVMALSACKTSATEFFSSKNALPTTLAEAGCNEAAANIS
QYVNKLSLGDAGAISVETKATGAKAAECTLTLTPTVTAGEITAWTGSHSGCDAKYVPANFR
MKNQKGFTLIELMIVVAIIAILAAIALPAYRDYTVRAKVSESVMALSACKTSATEFFSSKNALPTTLAEAGCNEAAANIS
QYVNKLSLGDAGAISVETKATGAKAAECTLTLTPTVTAGEITAWTGSHSGCDAKYVPANFR
Nucleotide
Download Length: 426 bp
>NTDB_id=296017 DM611_RS17690 WP_110714370.1 3795544..3795969(-) (comP) [Stenotrophomonas maltophilia strain SJTL3]
ATGAAGAACCAGAAGGGCTTCACCCTTATCGAACTGATGATCGTCGTTGCGATCATTGCTATCCTGGCCGCAATCGCGCT
GCCGGCTTACCGTGACTATACGGTTCGTGCCAAAGTCAGCGAATCTGTGATGGCGCTGAGTGCGTGCAAGACGTCGGCGA
CTGAATTCTTCTCCTCGAAGAACGCACTCCCGACCACTCTGGCCGAAGCAGGTTGCAACGAAGCGGCGGCTAACATCAGC
CAGTACGTTAACAAGCTTTCGCTGGGCGACGCTGGCGCTATCTCTGTAGAGACGAAGGCAACCGGTGCGAAGGCTGCCGA
ATGCACCCTGACTCTGACCCCGACTGTGACCGCCGGTGAGATCACTGCTTGGACTGGCAGCCACAGTGGTTGCGACGCAA
AGTACGTGCCGGCCAACTTCCGCTAA
ATGAAGAACCAGAAGGGCTTCACCCTTATCGAACTGATGATCGTCGTTGCGATCATTGCTATCCTGGCCGCAATCGCGCT
GCCGGCTTACCGTGACTATACGGTTCGTGCCAAAGTCAGCGAATCTGTGATGGCGCTGAGTGCGTGCAAGACGTCGGCGA
CTGAATTCTTCTCCTCGAAGAACGCACTCCCGACCACTCTGGCCGAAGCAGGTTGCAACGAAGCGGCGGCTAACATCAGC
CAGTACGTTAACAAGCTTTCGCTGGGCGACGCTGGCGCTATCTCTGTAGAGACGAAGGCAACCGGTGCGAAGGCTGCCGA
ATGCACCCTGACTCTGACCCCGACTGTGACCGCCGGTGAGATCACTGCTTGGACTGGCAGCCACAGTGGTTGCGACGCAA
AGTACGTGCCGGCCAACTTCCGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Acinetobacter baylyi ADP1 |
47.333 |
100 |
0.504 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
44.604 |
98.582 |
0.44 |
| pilA2 | Legionella pneumophila str. Paris |
44.604 |
98.582 |
0.44 |
| pilA/pilA1 | Eikenella corrodens VA1 |
41.216 |
100 |
0.433 |
| pilA | Haemophilus influenzae 86-028NP |
42.143 |
99.291 |
0.418 |
| pilA | Haemophilus influenzae Rd KW20 |
42.143 |
99.291 |
0.418 |
| pilA | Glaesserella parasuis strain SC1401 |
36.17 |
100 |
0.362 |
| pilA | Acinetobacter baumannii strain A118 |
38.931 |
92.908 |
0.362 |