Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | DC427_RS08420 | Genome accession | NZ_CP029030 |
| Coordinates | 1654746..1655057 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CAR | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1630942..1657087 | 1654746..1655057 | within | 0 |
Gene organization within MGE regions
Location: 1630942..1657087
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DC427_RS08275 | - | 1630942..1631478 (-) | 537 | WP_077442703.1 | IS30 family transposase | - |
| DC427_RS08280 | - | 1631459..1631962 (-) | 504 | WP_000746375.1 | transposase | - |
| DC427_RS08285 | - | 1632071..1632427 (-) | 357 | WP_001255379.1 | cystatin-like fold lipoprotein | - |
| DC427_RS08290 | - | 1632483..1633073 (-) | 591 | WP_000810443.1 | hypothetical protein | - |
| DC427_RS08295 | - | 1633080..1634126 (-) | 1047 | WP_000247465.1 | CHAP domain-containing protein | - |
| DC427_RS08300 | - | 1634116..1635963 (-) | 1848 | WP_000681154.1 | CD3337/EF1877 family mobilome membrane protein | - |
| DC427_RS08305 | - | 1635968..1637326 (-) | 1359 | WP_001251211.1 | FtsK/SpoIIIE domain-containing protein | - |
| DC427_RS08310 | - | 1637380..1639875 (-) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| DC427_RS08315 | - | 1639910..1640293 (-) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| DC427_RS08320 | - | 1640305..1640565 (-) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| DC427_RS08325 | - | 1640570..1641625 (-) | 1056 | WP_000692003.1 | conjugal transfer protein | - |
| DC427_RS08330 | - | 1641686..1642777 (-) | 1092 | WP_000172939.1 | replication initiation factor domain-containing protein | - |
| DC427_RS08335 | - | 1642952..1643254 (-) | 303 | WP_000386891.1 | hypothetical protein | - |
| DC427_RS08340 | - | 1643268..1643588 (-) | 321 | WP_000805733.1 | DUF961 family protein | - |
| DC427_RS08345 | - | 1643739..1644023 (-) | 285 | WP_000134545.1 | hypothetical protein | - |
| DC427_RS08350 | efp | 1644418..1644975 (-) | 558 | WP_000626504.1 | elongation factor P | - |
| DC427_RS08355 | - | 1645001..1646062 (-) | 1062 | WP_000087107.1 | M24 family metallopeptidase | - |
| DC427_RS08360 | - | 1646167..1646748 (+) | 582 | WP_000737686.1 | hypothetical protein | - |
| DC427_RS08365 | - | 1646762..1646980 (+) | 219 | WP_001244298.1 | SA1362 family protein | - |
| DC427_RS08370 | - | 1647044..1647874 (-) | 831 | WP_000141108.1 | biotin/lipoate A/B protein ligase family protein | - |
| DC427_RS08375 | - | 1648032..1648418 (+) | 387 | WP_001276571.1 | rhodanese-like domain-containing protein | - |
| DC427_RS08380 | gcvPB | 1648783..1650255 (-) | 1473 | WP_000202189.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| DC427_RS08385 | gcvPA | 1650248..1651594 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| DC427_RS08390 | gcvT | 1651614..1652705 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DC427_RS08395 | - | 1652864..1653388 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| DC427_RS08400 | - | 1653378..1653524 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| DC427_RS08405 | comGF | 1653621..1654118 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| DC427_RS08410 | comGE | 1654036..1654335 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| DC427_RS08415 | comGD | 1654322..1654768 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| DC427_RS08420 | comGC | 1654746..1655057 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| DC427_RS08425 | comGB | 1655071..1656141 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| DC427_RS08430 | comGA | 1656113..1657087 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=289367 DC427_RS08420 WP_000472256.1 1654746..1655057(-) (comGC) [Staphylococcus aureus strain CAR]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=289367 DC427_RS08420 WP_000472256.1 1654746..1655057(-) (comGC) [Staphylococcus aureus strain CAR]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |