Detailed information NTG0276414

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLWM1_RS11385
• Genome accession: NZ_CP032500
• Coordinates: 2217841..2218110 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain WM1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2212841..2223110

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLWM1_RS11345 (LLWM1_2172)	-	2213097..2213834 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LLWM1_RS11350 (LLWM1_2173)	-	2214011..2214853 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LLWM1_RS11355 (LLWM1_2174)	-	2214850..2215287 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LLWM1_RS11360 (LLWM1_2175)	-	2215494..2216441 (+)	948	WP_003130410.1	IS30 family transposase	-
LLWM1_RS11365 (LLWM1_2176)	comGG	2216415..2216741 (-)	327	WP_058221568.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLWM1_RS11370 (LLWM1_2177)	comGF	2216791..2217219 (-)	429	Protein_2212	competence type IV pilus minor pilin ComGF	-
LLWM1_RS11375 (LLWM1_2178)	comGE	2217182..2217478 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLWM1_RS11380 (LLWM1_2179)	comGD	2217450..2217881 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLWM1_RS11385 (LLWM1_2180)	comGC	2217841..2218110 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LLWM1_RS11390 (LLWM1_2181)	-	2218237..2218929 (-)	693	WP_152994386.1	hypothetical protein	-
LLWM1_RS11395 (LLWM1_2182)	-	2219171..2219950 (-)	780	WP_082225220.1	peptidoglycan amidohydrolase family protein	-
LLWM1_RS11400 (LLWM1_2183)	-	2219950..2220249 (-)	300	WP_031559226.1	phage holin	-
LLWM1_RS11405 (LLWM1_2184)	-	2220262..2220612 (-)	351	WP_014570798.1	hypothetical protein	-
LLWM1_RS11410 (LLWM1_2185)	-	2220625..2220861 (-)	237	WP_082225257.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=276414 LLWM1_RS11385 WP_003129998.1 2217841..2218110(-) (comGC) [Lactococcus lactis subsp. lactis strain WM1]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=276414 LLWM1_RS11385 WP_003129998.1 2217841..2218110(-) (comGC) [Lactococcus lactis subsp. lactis strain WM1]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404